Copy Link Print Information

Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen.It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance.Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF-alpha/TNFSF2 protein, expressed by E.coli , with C-His, C-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen.It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance.Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF-alpha/TNFSF2 protein, expressed by E.coli , with C-His, C-His labeled tag.This product is for cell culture use only.

Background

TNF-alpha/TNFSF2 Protein is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Secreted mainly by macrophages, it can induce cell death in certain tumor cell lines. Additionally, it acts as a potent pyrogen, causing fever through direct action or by stimulating interleukin-1 secretion and is implicated in the induction of cachexia. Under specific conditions, it can stimulate cell proliferation and promote cell differentiation. In adipocytes, it induces insulin resistance by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, while also leading to GKAP42 protein degradation, contributing to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6. Furthermore, it facilitates osteoclastogenesis, thereby mediating bone resorption. Finally, the TNF intracellular domain (ICD) form of TNF-alpha/TNFSF2 Protein stimulates IL12 production in dendritic cells.

Verified Bioactivity

Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED50 for this effect is <40 pg/mL. The specific activity of recombinant mouse TNF alpha is approximately >2.5x 107 IU/mg

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession

    P06804 (L80-L235)

  • Gene ID
    21926  [NCBI]
  • Molecular Construction
    • N-term
    • TGF-α (L80-L235)
      Accession # P06804
    • 6*His
    • C-term
  • Protein Length

    Full Length of TNF, soluble form

  • Synonyms

    TNF; Tumor Necrosis Factor (TNF Superfamily, Member 2); Prev. TNFA; Tumor Necrosis Factor-Alpha; TNF-Alpha; Tumor Necrotic Factor Alpha; TNFSF2; TNF Superfamily, Member 2; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF, Macrophage-Derived; TNF-A;

  • AA Sequence

    LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

  • Predicted Molecular Mass

    18.2 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His) Product Image
    1/16
  • Animal-Free TNF-alpha/TNFSF2 Protein, Mouse (His) Product Image