Animal-Free VEGF165 Protein, Human (His)

VEGF145 Protein, with limited expression, exhibits specialized distribution and is not broadly present in tissues. Its restricted occurrence implies a specific, context-dependent role in physiological processes. Further research is needed to unveil the specific cellular contexts and functions where VEGF145 actively participates, providing insights into its potential contributions to localized biological activities. Animal-Free VEGF165 Protein, Human (His) is the recombinant human-derived animal-FreeVEGF165 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free VEGF165 Protein, Human (His) is 165 a.a., with molecular weight of ~20.11 kDa.

VEGF145 Protein, characterized by limited expression, is not widely distributed across tissues or cell types. The restricted occurrence of VEGF145 suggests a specialized and possibly context-specific role in physiological processes. Further investigation is warranted to uncover the specific cellular contexts and functions in which VEGF145 is actively involved, shedding light on its potential contributions to localized biological activities.

Measure by its ability to induce HUVEC cells proliferation. The ED₅₀ for this effect is <5 ng/mL. The specific activity of recombinant human VEGF165 is approximately >1.4 x 10⁶ IU/mg.

Human

E. coli

C-His

P15692-4 (A27-R191)

7422  [NCBI]

MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Approximately 20.11 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.