1. Recombinant Proteins
  2. Others
  3. Apolipoprotein A-II/APOA2 Protein, Human (HEK293, His)

Apolipoprotein A-II/APOA2 Protein, Human (HEK293, His)

Cat. No.: HY-P7527
COA Handling Instructions

Apolipoprotein A-II/ApoA2 Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-II (ApoA-II) has been associated with numerous aspects of HDL metabolism, and apoA-II overexpression produces the proatherogenic phenotype.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $210 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Apolipoprotein A-II/ApoA2 Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-II (ApoA-II) has been associated with numerous aspects of HDL metabolism, and apoA-II overexpression produces the proatherogenic phenotype[1].

Background

Recombinant apoA-II is comparable to the plasma form in its ability to bind and reorganize lipid and promote cholesterol efflux from macrophages via the ATP binding cassette transporter A1. Synthesized primarily in the liver, apoA-II is a 77 amino acid protein with a single cysteine at position. In healthy humans, apoA-II exists almost entirely as a disulfide-linked homodimer (molecular mass, 17.4 kDa), though it can be occasionally found as a heterodimer with other Cys-containing proteins[1].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P02652 (Q24-Q100)

Gene ID

336  [NCBI]

Synonyms
rHuApolipoprotein A-II, His; ApoA2; Apolipoprotein A-II
AA Sequence

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQHHHHHH

Molecular Weight

10-15 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Apolipoprotein A-II/APOA2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein A-II/APOA2 Protein, Human (HEK293, His)
Cat. No.:
HY-P7527
Quantity:
MCE Japan Authorized Agent: