Apolipoprotein A-II/APOA2 Protein, Human (Truncated, HEK293, His)
Based on 1 Customer Validation
Apolipoprotein A-II/APOA2 Protein, Human (Truncated, HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-II (ApoA-II) has been associated with numerous aspects of HDL metabolism, and apoA-II overexpression produces the proatherogenic phenotype.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Apolipoprotein A-II/APOA2 Protein, Human (Truncated, HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-II (ApoA-II) has been associated with numerous aspects of HDL metabolism, and apoA-II overexpression produces the proatherogenic phenotype[1].
Background
Recombinant apoA-II is comparable to the plasma form in its ability to bind and reorganize lipid and promote cholesterol efflux from macrophages via the ATP binding cassette transporter A1. Synthesized primarily in the liver, apoA-II is a 77 amino acid protein with a single cysteine at position. In healthy humans, apoA-II exists almost entirely as a disulfide-linked homodimer (molecular mass, 17.4 kDa), though it can be occasionally found as a heterodimer with other Cys-containing proteins[1].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P02652 (Q24-Q100)
-
Molecular Construction
-
N-term
-
APOA2 (Q24-Q100)
Accession # P02652 -
6*His
-
C-term
-
-
Protein Length
Full Length of Apolipoprotein A-II Chain
-
Synonyms
APOA2; Apolipoprotein; Apolipoprotein A2; Plasminogen; Apolipoprotein A-II; ApoAII; ApoA-II; APOA2D; Apo-AII; Apo(A); Apolipoprotein A-II, Isoform CRA_a; PLGL
-
AA Sequence
QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
-
Predicted Molecular Mass
9.7 kDa
-
Molecular Weight
Approximately 10-15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
