1. Recombinant Proteins
  2. Apolipoprotein A-II/ApoA2 Protein, Human (HEK293, His)

Apolipoprotein A-II/ApoA2 Protein, Human (HEK293, His)

Cat. No.: HY-P7527
Handling Instructions

Apolipoprotein A-II/ApoA2 Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-II (ApoA-II) has been associated with numerous aspects of HDL metabolism, and apoA-II overexpression produces the proatherogenic phenotype[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $210 Ask For Quote & Lead Time
50 μg $590 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuApolipoprotein A-II, His; ApoA2; Apolipoprotein A-II
Species

Human

Source

HEK 293

Accession

P02652 (Q24-Q100)

Gene ID

336

Molecular Weight

10-15 kDa

AA Sequence

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQHHHHHH

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant apoA-II is comparable to the plasma form in its ability to bind and reorganize lipid and promote cholesterol efflux from macrophages via the ATP binding cassette transporter A1. Synthesized primarily in the liver, apoA-II is a 77 amino acid protein with a single cysteine at position. In healthy humans, apoA-II exists almost entirely as a disulfide-linked homodimer (molecular mass, 17.4 kDa), though it can be occasionally found as a heterodimer with other Cys-containing proteins[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein A-II/ApoA2 Protein, Human (HEK293, His)
Cat. No.:
HY-P7527
Quantity:
MCE Japan Authorized Agent: