Apolipoprotein E/APOE4 Protein, Human (C130R, HEK293, Fc, solution)

Apolipoprotein E (APOE) plays a key role in lipoprotein-mediated lipid transport and is a core component in the production, transformation, and clearance of plasma lipoproteins. As an amphipathic molecule, APOE binds to various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, favoring HDL. Apolipoprotein E/APOE Protein, Human (C130R, HEK293, Fc) is the recombinant human-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with N-hFc labeled tag and C130R mutation.

Apolipoprotein E (APOE) is a crucial player in lipoprotein-mediated lipid transport, serving as a core component of plasma lipoproteins involved in their production, conversion, and clearance. Functioning as an amphipathic molecule, APOE associates with various lipoprotein particles, including chylomicrons, chylomicron remnants, very low-density lipoproteins (VLDL), and intermediate density lipoproteins (IDL), with a preference for high-density lipoproteins (HDL). It engages with a range of cellular receptors, such as the LDL receptor (LDLR), LDL receptor-related proteins (LRP1, LRP2, and LRP8), and the very low-density lipoprotein receptor (VLDLR), facilitating cellular uptake of APOE-containing lipoprotein particles. Additionally, APOE exhibits heparin-binding activity, interacting with heparan-sulfate proteoglycans on cell surfaces, supporting the capture and receptor-mediated uptake of APOE-containing lipoproteins. APOE's main function involves mediating lipoprotein clearance through hepatocyte uptake and participating in the biosynthesis and uptake of VLDLs by peripheral tissues for triglyceride delivery and energy storage. It crucially contributes to lipid homeostasis, participating in reverse cholesterol transport and playing roles in the central nervous system, immune responses, and transcriptional regulation, notably in interactions with HCV during microbial infection.

Human

HEK293

N-hFc

P02649 (K19-H317, C130R)

348  [NCBI]

Full Length of Mature Protein

KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

63-67 kDa (Due to glycosylation)

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.