1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. APRIL Proteins
  6. APRIL/TNFSF13 Protein, Mouse

APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture. APRIL protein has been widely used in the study of lymphatic malignancies. Mouse APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. APRIL/TNFSF13 Protein, Mouse is produced by E. coli (R50-L241) with length of 192 amino acids.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process[1]. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture[2]. APRIL protein has been widely used in the study of lymphatic malignancies. Mouse APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. APRIL/TNFSF13 Protein, Mouse is produced by E. coli (R50-L241) with length of 192 amino acids.

Background

APRIL/TNFSF13 Protein is a cytokine and an independent secretory ligand belongs to TNF family. It binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. APRIL/TNFSF13 Protein plays a role in the regulation of tumor cell growth, may involve in monocyte/macrophage-mediated immunological processes[1].
APRIL is produced by myeloid cells and their precursors in the bone marrow. APRIL is retained by surrounding tissues and via HSPG (heparan sulfate proteoglycans) is not retained. It accumulates in large amounts in the bone marrow, leading to more rapid cell maturation and peripheral burst. As for infection response, tonsil mucosa neutrophils present within the infected tissue were the main source of APRIL, whereas keratinocytes were the primary source of APRIL in tissues showing no symptoms of infection[2].
APRIL acts function by binding BCMA (B cell maturation antigen) and TACI (transmembrane activator and CAML-interactor) and competes with TALL-I (also called BLyS or BAFF) for receptor binding. Soluble BCMA and TACI specifically prevent binding of APRIL and block APRIL-stimulated proliferation of primary B cells, and soluble BCMA is a dominant-negative molecule capable of inhibiting antibody production in vivo. Thus, APRIL stimulates in vitro the proliferation of primary lymphocytes, in addition to lymphoma cell lines, and promotes in vivo the accumulation of B cells in the spleen. Therefore, APRIL-TALL-I and BCMA-TACI form a two ligands-two receptors pathway involved in stimulation of B and T cell function. Moreover, APRIL is also a stimulator of tumor cell growth although TNRF death ligand-1 (TRDL-1), which induces tumor cell apoptosis[1].
It is a type II membrane protein with a cytoplasmic domain, a hydrophobic transmembrane region, and an extracellular domain[2]. Mouse and human APRIL proteins are 82% identical in the COOH-terminal part of the extracellular domain, which contains the presumed receptor-binding domain. And the protein sequences of human and mouse are different with similarity of 80.91%. The APRIL protein is most often studied in the context of lymphoid malignancies[1].

In Vitro

APRIL (mouse; -1 mg/mL) stimulates proliferation of primary B cells[1].
Flag-APRIL (mouse; 1 µg/mL) binds to A2 cells in the absence or presence of threefold excess on a molar basis of a soluble TNFR homolog competitor[1].
Long Flag-APRIL (murine; 5-24 nM) binds to BCMA and TACI with Kd values of 1.31 nM and .6 nM, respectively[1].
Short Flag-APRIL (murine; 11-24 nM) binds to BCMA and TACI with Kd values of .15 nM and 1.5 nM, respectively[1].

In Vivo

APRIL (mouse; 1 mg/kg/d; i.p.; 5 d) results an increase in spleen weight and B cell numbers of mice accompanied by a decrease in those of CD4+ and CD8+ T cells[1].

Actividad biológica

Measured by its ability to induce cell proliferation of RPMI 8226 Cells.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9D777 (R50-L241)

Gene ID
Molecular Construction
N-term
APRIL (R50-L241)
Accession # Q9D777
C-term
Protein Length

Partial

Synonyms
rMuApril/TNFSF13; TNFSF 13; TNFSF-13; CD256
AA Sequence

RREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL

Peso molecular

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM acetic acid.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

APRIL/TNFSF13 Protein, Mouse

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
APRIL/TNFSF13 Protein, Mouse
Cat. No.:
HY-P7320
Cantidad:
MCE Japan Authorized Agent: