ARF1 Protein, Human (His-GST, Myc)
Based on 1 Customer Validation
ARF1 is a small GTPase responsible for coordinating protein transport within the Golgi complex. In its GTP-bound state, ARF1 critically regulates Golgi vesicle budding and uncoating by recruiting coat proteins. ARF1 Protein, Human (His-GST, Myc) is the recombinant human-derived ARF1 protein, expressed by E. coli , with N-10*His, C-Myc, GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ARF1 is a small GTPase responsible for coordinating protein transport within the Golgi complex. In its GTP-bound state, ARF1 critically regulates Golgi vesicle budding and uncoating by recruiting coat proteins. ARF1 Protein, Human (His-GST, Myc) is the recombinant human-derived ARF1 protein, expressed by E. coli , with N-10*His, C-Myc, GST labeled tag.
Background
ARF1, a small GTPase, intricately participates in protein trafficking among distinct cellular compartments, notably within the Golgi complex. In its GTP-bound state, ARF1 plays a pivotal role in modulating vesicle budding and uncoating processes within the Golgi, orchestrating the recruitment of coatomer proteins to the Golgi membrane. The subsequent hydrolysis of ARF1-bound GTP, facilitated by ARFGAPs proteins, becomes essential for the dissociation of coat proteins from Golgi membranes and vesicles. Additionally, the GTP-bound form of ARF1 interacts with PICK1, regulating AMPA receptor (AMPAR) trafficking and influencing synaptic plasticity of excitatory synapses, as well as spine shrinkage during long-term depression (LTD). In the context of microbial infection, ARF1 takes on an unexpected role as an allosteric activator of the cholera toxin catalytic subunit, functioning in ADP-ribosyltransferase activity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc;N-GST
-
Accession
P84077 (G2-K181)
-
Molecular Construction
-
N-term
-
10*His-GST
-
ARF1 (G2-K181)
Accession # P84077 -
Myc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ARF1; ADP-Ribosylation Factor 1; ARF GTPase 1; ADP-Ribosylation Factor; ADP Ribosylation Factor 1; PVNH8
-
AA Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
-
Predicted Molecular Mass
55.7 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)