ARF1 Protein, Human (His-GST, Myc)

Customer Review

Based on 1 Customer Validation

ARF1 is a small GTPase responsible for coordinating protein transport within the Golgi complex. In its GTP-bound state, ARF1 critically regulates Golgi vesicle budding and uncoating by recruiting coat proteins. ARF1 Protein, Human (His-GST, Myc) is the recombinant human-derived ARF1 protein, expressed by E. coli , with N-10*His, C-Myc, GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ARF1 is a small GTPase responsible for coordinating protein transport within the Golgi complex. In its GTP-bound state, ARF1 critically regulates Golgi vesicle budding and uncoating by recruiting coat proteins. ARF1 Protein, Human (His-GST, Myc) is the recombinant human-derived ARF1 protein, expressed by E. coli , with N-10*His, C-Myc, GST labeled tag.

Background

ARF1, a small GTPase, intricately participates in protein trafficking among distinct cellular compartments, notably within the Golgi complex. In its GTP-bound state, ARF1 plays a pivotal role in modulating vesicle budding and uncoating processes within the Golgi, orchestrating the recruitment of coatomer proteins to the Golgi membrane. The subsequent hydrolysis of ARF1-bound GTP, facilitated by ARFGAPs proteins, becomes essential for the dissociation of coat proteins from Golgi membranes and vesicles. Additionally, the GTP-bound form of ARF1 interacts with PICK1, regulating AMPA receptor (AMPAR) trafficking and influencing synaptic plasticity of excitatory synapses, as well as spine shrinkage during long-term depression (LTD). In the context of microbial infection, ARF1 takes on an unexpected role as an allosteric activator of the cholera toxin catalytic subunit, functioning in ADP-ribosyltransferase activity.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His;C-Myc;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His-GST
    • ARF1 (G2-K181)
      Accession # P84077
    • Myc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    ARF1; ADP-Ribosylation Factor 1; ARF GTPase 1; ADP-Ribosylation Factor; ADP Ribosylation Factor 1; PVNH8

  • AA Sequence

    GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

  • Predicted Molecular Mass

    55.7 kDa

  • Molecular Weight

    Approximately 55 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00