1. Recombinant Proteins
  2. Immune Checkpoint Proteins CAR-T Related Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H3 B7-H3/CD276
  5. CD276/B7-H3 Protein, Human (HEK293, Fc)

CD276/B7-H3 Protein, Human (HEK293, Fc) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. B7-H3 is an immune checkpoint from the B7 family of molecules.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

CD276/B7-H3 Protein, Human (HEK293, Fc) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. B7-H3 is an immune checkpoint from the B7 family of molecules.

Background

As a member of the B7 family, inducible co-stimulator ligand (ICOSLG) expressed on tumor cell has been reported to have an important role in tumor immunity. As the counter ligand of ICOS, a CD28-related molecule, ICOSLG is expressed on professional antigen-presenting cell (APCs; such as dendritic cells (DCs) and B cells) and on some tumor cells (such as glioma cells and gastric carcinoma cells). ICOSLG is the only B7 family member that preferentially co-stimulates type 2T helper cell (Th2) responses, and interestingly, this unique molecule has a critical role in antitumor immunity. ICOSLG expression on solid tumors (implanted-transfected tumors) aids in both NK mediated and CD8+ cytotoxic T cell (CTL) activation and killing. Several studies using ICOSLG-transfected solid tumor cell lines found that ICOSLG induced CD8+ cytotoxic lymphocyte-mediated tumor regression[1].

Actividad biológica

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated Jurkat cells T lymphocytes cultured for 72 hours were incubated for an additional 3 days in 96 well plates coated with 10 μg/mL anti-CD3 and 10 µg/mL B7-H3.The presence of B7-H3 at 10 µg/mL inhibited the anti-CD3 response is 31.599 %.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q5ZPR3-2 (L29-P245)

Gene ID
Molecular Construction
N-term
CD276 (L29-P245)
Accession # Q5ZPR3-2
hFc
C-term
Protein Length

Partial

Synonyms
rHuB7-H3/ICOSLG, Fc Chimera; B7H3; B7 homolog 3; CD276
AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

Peso molecular

62-65 kDa

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

CD276/B7-H3 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
CD276/B7-H3 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P7326
Cantidad:
MCE Japan Authorized Agent: