1. Recombinant Proteins
  2. Immune Checkpoint Proteins Biotinylated Proteins
  3. Inhibitory checkpoint molecules
  4. B7-H4
  5. B7-H4 Protein, Human (Biotinylated, HEK 293, Fc-Avi)

B7-H4 Protein, Human (Biotinylated, HEK 293, Fc-Avi)

Cat. No.: HY-P72341
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
20 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
Measured by its binding ability in a functional ELISA. 2 μg/mL (100 μL/well) of immobilized Anti-Human B7-H4 mAb can bind Biotinylated B7-H4, Human (HEK 293, Fc-AVi) with an ED50 value of 0.23 ng/mL.
Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

Q7Z7D3 (F29-A258)

Gene ID
Synonyms
B7S1; B7x; Vtcn1; B7h.5; B7S1VCTN1; B7XPRO1291; FLJ22418; Protein B7S1; T cell costimulatory molecule B7x; V-set domain containing T cell activation inhibitor 1
AA Sequence

FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSK

Molecular Weight

70-95 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

B7-H4 Protein, Human (Biotinylated, HEK 293, Fc-Avi) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-H4 Protein, Human (Biotinylated, HEK 293, Fc-Avi)
Cat. No.:
HY-P72341
Quantity:
MCE Japan Authorized Agent: