B7-H4 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Based on 1 Customer Validation
The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
Background
B7-H4 protein functions as a negative regulator of the T-cell-mediated immune response, exerting inhibitory effects on T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Particularly significant when expressed on the cell surface of tumor macrophages, B7-H4, in collaboration with regulatory T-cells (Treg), plays a crucial role in suppressing tumor-associated antigen-specific T-cell immunity. Additionally, B7-H4 is implicated in the promotion of epithelial cell transformation, indicating its multifaceted involvement in modulating immune responses and cellular processes associated with tumor development.
Verified Bioactivity
Immobilized Anti-Human B7-H4 mAb at 2 μg/ml (100 μl/well) can bind Biotinylated Human B7-H4-Fc-Avi. The ED50 of Biotinylated Human B7-H4-Fc-Avi is 0.15 ng/ml.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-hFc
-
Accession
Q7Z7D3-1 (F29-A258)
-
Molecular Construction
-
N-term
-
B7-H4 (F29-A258)
Accession # Q7Z7D3-1 -
hFc-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
VTCN1; V-Set Domain Containing T Cell Activation Inhibitor 1; B7-H4; B7H4; B7h.5; B7S1; B7x; V-Set Domain-Containing T-Cell Activation Inhibitor 1; Immune Costimulatory Protein B7-H4; B7 Superfamily Member 1; B7 Family Member, H4; B7 Homolog 4; FLJ22418;
-
AA Sequence
FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
-
Predicted Molecular Mass
54.1 kDa
-
Molecular Weight
Approximately 70-95 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
