B7-H6 Protein, Cynomolgus (HEK293, Fc)

B7-H6 Protein is a member of B7 family that serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors. In addition, B7-H6 promotes tumorigenesis via apoptosis inhibition, proliferation and immunological progression. B7-H6 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived B7-H6 protein, expressed by HEK293 , with C-hFc labeled tag.

B7-H6, a member of B7 family, serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors, such as NCR1, NCR2, and KLRK1. This interaction highlights its unique role in initiating NK cell responses through the NCR3 pathway, showcasing its specificity in the intricate network of NK cell activation mechanisms. B7-H6 has unique immunogenic properties, is a ligand of NKp30, which is an activating receptor of natural killer (NK) cells. High expression of B7-H6 is found in certain types of tumor cells, such as lymphoma, leukemia and gastric carcinoma. The expression of B7-H6 can be induced by inflammatory stress in healthy cells. In addition, B7‐H6 enhances the initiation of “caspase cascades” and anti-apoptosis role to provoke tumorigenesis via the STAT3 activation. B7‐H6 promotes tumor proliferation and G0/G1 cycle process by regulating the downstream apoptosis suppressors survivin, Mcl‐1, Bcl‐2, and Bcl‐xL. It induces cellular cytotoxicity, TNF-α and IFN-γ secretion by mediating IL-6 expression and B7-H6-specific BiTE triggers T cell to facilitate tumorigenesis. All these molecular mechanisms are involved in B7-H6-induced tumorigenesis^[1].

Cynomolgus

HEK293

C-hFc

XP_005578557 (D25-D259)

102121659  [NCBI]

Partial

DLKVEMMARGIQATRLNDSVTISCKVIYSQPLNITSMGITWFRKSLTLDKEVKVFEFFGDHQKAFRPGANVSLWRLKSGDASLKLPGVQLEEAGEYRCEVVVTPLKAQGTVQLKVVASPTSRLFQDQAVVKENEGKYMCESSRFYPKDINITWEKWTQKSPHHVVISENVITGPTIKNMDGTFNITSYLKLNSSQEDPGTVYRCVIRHESLHTPVSIDFILTAPQQSLSEPEKTD

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.