BAFFR/TNFRSF13C Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

BAFF Receptor (B-cell activating factor receptor, BAFF-R), also known as TNFRSF13C and BR3, is a membrane protein of the TNF receptor superfamily which recognizes BAFF. BAFF Receptor is the crucial receptor for B-cell survival and also is a potent costimulator of both B and T cell activation. BAFFR/TNFRSF13C Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, produced in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

BAFF Receptor (B-cell activating factor receptor, BAFF-R), also known as TNFRSF13C and BR3, is a membrane protein of the TNF receptor superfamily which recognizes BAFF. BAFF Receptor is the crucial receptor for B-cell survival and also is a potent costimulator of both B and T cell activation[1]. BAFFR/TNFRSF13C Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, produced in HEK293 cells.

Background

BAFF Receptor is expressed on all B cells (except plasma cells), including immature, transitional, mature, memory, and germinal center B cells, as well as on plasma cells[2], while BAFF-R is also expressed on follicular helper T cells (TFH)[3].
The amino acid sequence of human BAFF Receptor protein has low homology for mouse and rat BAFF Receptor protein.
BAFF Receptor binds to BAFF and recruits TNF receptor-associated factor 3 (TRAF-3) and TRAF-2 to the intracellular domain of BAFF-R molecules. The binding of TRAF3 to the BAFF-R reverses the inhibitory effect of unbound/cytoplasmic TRAF3 on the alternative NF-κB2 signaling pathway. It releases NF-κB-inducing kinase (NIK), which phosphorylates inhibitor of κB kinase 1 (IKK1) leading to activation of non-canonical NF-κB. BAFF-R signaling is critical for peripheral B cell survival and differentiation, germinal center formation, plasma cell survival, and IgG and IgE class switching[2].
BAFF Receptor binds to BAFF mediates B-cell survival, proliferation, and differentiation, and involves in the formation of GCs in secondary follicles in murine models and tertiary lymphoid structures in autoimmune diseases[3]. BAFF/BAFF-R signaling is crucial for primary B cell survival, differentiation and homeostasis[4]. A/WySnJ mice expressing a defective BAFF-R have disrupted B cell maturation, similar to that seen in BAFF-deficient mice[5].

In Vitro

BAFF Receptor (human) (500 ng/mL; 30 min) inhibits BAFF-mediated proliferation of human mesangial cells when co-cultured with 20 ng/mL BAFF for 48h[4].

In Vivo

Human BAFF-R deficiency strongly impairs the development and homeostasis of follicular, IgM memory/marginal zone, and class-switched memory B cells[6].

Verified Bioactivity

Immobilized Human BAFF-Fc at 2 μg/mL (100 μL/well) can bind Human BAFFR-His. The ED50 of Human BAFFRHis is 1.0-300 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • BAFFR (S7-A71)
      Accession # Q96RJ3-1
    • 6*His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    TNFRSF13C; BLyS Receptor 3; TNF Receptor Superfamily Member 13C; B Cell-Activating Factor Receptor; BAFFR; B-Cell-Activating Factor Receptor; BAFF Receptor; CD268 Antigen; BAFF-R; Prolixin; CD268; BROMIX; Tumor Necrosis Factor Receptor Superfamily, Member

  • AA Sequence

    SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA

  • Predicted Molecular Mass

    7.4 kDa

  • Molecular Weight

    Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 5% trehalose, 5% mannitol, 0.02% Tween 80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00