BAFF/TNFSF13B Protein, Rhesus Macaque (HEK293, Fc)

The BAFF/TNFSF13B protein is a member of the tetraspanin (TM4SF) family and is actively involved in a variety of cellular processes. BAFF/TNFSF13B is a component of the tetraspanin superfamily and is critical for cell adhesion, migration, and signaling events. BAFF/TNFSF13B Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived BAFF/TNFSF13B protein, expressed by HEK293 , with N-hFc labeled tag. The total length of BAFF/TNFSF13B Protein, Rhesus Macaque (HEK293, Fc) is 152 a.a., with molecular weight of 45-55 kDa.

CD53, a member of the tetraspanin (TM4SF) family, is a transmembrane protein involved in various cellular processes. As a part of the larger tetraspanin superfamily, CD53 plays a crucial role in mediating cell adhesion, migration, and signaling events. This family is characterized by proteins with four transmembrane domains, contributing to the formation of multimolecular complexes on the cell surface known as tetraspanin-enriched microdomains (TEMs). CD53, like other tetraspanins, is known to interact with partner proteins, including integrins and other tetraspanins, influencing cellular functions such as immune responses, cell adhesion, and signal transduction. The diverse functions of CD53 underscore the importance of tetraspanins in modulating cellular behavior and their potential as therapeutic targets in various physiological and pathological contexts.

Rhesus Macaque

HEK293

N-hFc

F7HHH0 (A134-L285)

693917  [NCBI]

AIQGAEETVIQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

45-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.