1. Recombinant Proteins
  2. BCA-1/CXCL13 Protein, Human

BCA-1/CXCL13 Protein, Human

Cat. No.: HY-P7131
Handling Instructions

BCA-1/CXCL13 Protein, Human is identified as an efficacious and selective attractant for B lymphocytes, also acts as a B cell homing chemokine.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $420 Get quote
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuBCA-1/CXCL13; C-X-C motif chemokine 13; BCA1; BLC; SCYB13
Species

Human

Source

E. coli

Accession

O43927 (V23-P109)

Gene ID

10563

Molecular Weight

Approximately 10.3 kDa

AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Biological Activity
Full biological activity determined by a chemotaxis bioassay using human B cells is in a concentration range of 1.0-10 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 100 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Human BCA-1/CXCL13 is identified as an efficacious and selective attractant for B lymphocytes, also acts as a B cell homing chemokine. Human BCA-1 competes with radiolabeled interferon gamma (IFN-γ) inducible protein 10 (IP-10) for binding to the human CXCR3 receptor. Furthermore, human BCA-1 is an efficacious attractant for human CXCR3 transfected cells; BCA-1-induced chemotaxis is inhibited by a monoclonal antibody against human CXCR3. Indeed, BCA-1 attenuates the calcium flux induced by IP-10. In addition, human BCA-1 is an agonist in stimulating GTPγS binding[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BCA-1/CXCL13 Protein, Human
Cat. No.:
HY-P7131
Quantity:
MCE Japan Authorized Agent: