1. Protéines recombinantes
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. BCA-1/CXCL13
  6. BCA-1/CXCL13 Protein, Human

CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches. BCA-1/CXCL13 Protein, Human is produced in E. coli, and consists of 87 amino acids (V23-P109).

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
Échantillon gratuit   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
500 μg En stock
1 mg En stock
> 1 mg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

  • Références

Description

CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor[1]. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches[2]. BCA-1/CXCL13 Protein, Human is produced in E. coli, and consists of 87 amino acids (V23-P109).

Background

CXCL13, also known as B lymphocyte chemoattractant, is originally identified in stromal cells in B cell follicles as regulating homing of B cells and subsets of T cells. CXCL13 plays a key role in orchestrating cell migration within spatially distinct regions of the secondary lymphoid organs. It strongly attracts B lymphocytes while promoting migration of only small numbers of T cells and macrophages. CXCL13 and its receptor, CXCR5, play fundamental roles in inflammatory, infectious, cancer and immune responses[1][2][3].
The amino acid sequence of human CXCL13 protein has low homology with mouse CXCL13 protein.
CXCL13 exerts its functions through its receptor CXCR5. CXCR5 is highly expressed on mature recirculating B-lymphocytes, a subpopulation of follicular helper T cells (TFH) and skin-derived migratory dendritic cells (DCs), and controls their migration into secondary lymphoid organs towards the gradient of CXCL13. As the loss of the BLR1/CXCR5 receptor is sufficient to disrupt organization of follicles in spleen and Peyer's patches, BCA-1 may act as a B cell homing chemokine. Human BCA-1 competes with radiolabeled IFN-γ inducible protein 10 (IP-10) for binding to the human CXCR3 receptor expressed in Ba/F3 and 293EBNA cell lines. Furthermore, human BCA-1 is an efficacious attractant for human CXCR3 transfected cells. BCA-1 does oes not induce calcium release in B-lymphocytes. In addition, human BCA-1 is an agonist in stimulating GTP gamma S binding. Human BCA-1 is a specific and functional G-protein-linked chemotactic ligand for the human CXCR3 receptor. CXCL13 has been widely implicated in the pathogenesis of a number of autoimmune diseases and inflammatory conditions, as well as in lymphoproliferative disorders. In addition, the CXCL13:CXCR5 axis orchestrates cell-cell interactions that regulate lymphocyte infiltration within the tumor microenvironment[1][2][3].
Dysregulation of the CXCL13:CXCR5 axis affecting both B- and TFH cell function is major player in autoimmune disorders, and potentially serves as a biomarker for disease progression and therapeutic response. Moreover, expression of CXCR5 and CXCL13 is shown to be dysregulated in HIV infection, such that the number of CXCR5+ B cells decreases with progression of HIV infection, together with an increase in plasma levels of CXCL13. CXCL13/CXCR5 signaling modulates cancer cell ability to grow, proliferate, invade, and metastasize. CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5[1][2][3][4].

In Vitro

Recombinant human CXCL13 (0-15 ng/mL; for 0-6 h) dose dependently induces CXCR5 expression in SAKA-T and MC3T3-E1 cells. Also, CXCL13 (15 ng/mL; 0-60 min) significantly increases p-ERK1/2 in SAKA-T and MC3T3-E1 cells[5].

Activité biologique

1.Full biological activity determined by a chemotaxis bioassay using human B cells is in a concentration range of 1.0-10 ng/mL.
2.Measured in a cell proliferation assay using PC-3 cells. The ED50 for this effect is typically 4.604 ng/mL, corresponding to a specific activity is 2.17×105 units/mg.

  • Measured in a cell proliferation assay using PC-3 cells. The ED50 for this effect is typically 4.604 ng/mL, corresponding to a specific activity is 2.17×105 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

O43927 (V23-P109)

Gene ID
Molecular Construction
N-term
CXCL13 (V23-P109)
Accession # O43927
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuBCA-1/CXCL13; C-X-C motif chemokine 13; BCA1; BLC; SCYB13
AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Predicted Molecular Mass
10.3 kDa
Masse moléculaire

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Pureté
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 100 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation
Références

BCA-1/CXCL13 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

BCA-1/CXCL13 Protein, Human

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
BCA-1/CXCL13 Protein, Human
Cat. No.:
HY-P7131
Quantité:
MCE Japan Authorized Agent: