1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Neurotrophins/NGF
  5. Brain Derived Neurotrophic Factor (BDNF)
  6. BDNF Protein, Human/Mouse/Rat

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt). BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS. BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

    BDNF Protein, Human/Mouse/Rat purchased from MCE. Usage Cited in: Front Public Health. 2021 Nov 22;9:771508.  [Abstract]

    Example images of primary hippocampal neruons were taken with a 20✕ optical microscope and recognized by ImageJ software. BDNF Protein (40 ng/ml) was incubated with primary hippocampal neurons for 48 hours as a positive control. MEK1/2 inhibitor PD98059 (50μM) was treated neurons for 48 hours as a negative control. BDNF treatment of primary hippocampal neurons could increase the average neurites length by 50% compared with sham, and could promote the number of primary neurites. However, PD98059 treatment of inhibited average neurites length by about 60%, and decreased the number of primary, secondary neurites and branch points per neuron.
    • Actividad biológica

    • Technical Parameters

    • Properties

    • Descripciòn

    • Referencias

    Descripciòn

    Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt)[1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. BDNF Protein, Human is a recombinant human BDNF (H129-R247) without tag, which is produced in E.coli.

    Background

    BDNF, a neurotrophin that belongs to NGF-beta family. BDNF is widely expressed in the CNS, gut and other tissues. BDNF regulates neurodevelopmental processes, including maturation, survival and differentiation of neuronal populations, and synaptic plasticity[1].
    BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt), thereby inducing increased Ca2+ intake and phosphorylation of transcription factors. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB. The activation of p75NTR increases apoptotic and inflammatory signaling in neurons and glial cells by activation of c-Jun N-terminal kinases (JNK) and NF-κB expression, respectively[2]. In human, decreased levels of BDNF are associated with neurodegenerative diseases (such as Parkinson's disease and Alzheimer's disease) and type 2 diabetes mellitus[1]. Human BDNF shares >97% aa sequence identity with mouse and rat. Rat BDNF shares >99% aa sequence identity with mouse.
    BDNF is a neurotransmitter modulator which is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory[1].

    In Vitro

    BDNF (human, 50 ng/mL, 3 days) increases percentage of neurite-bearing cells in PC12 cells[3].

    In Vivo

    BDNF (human, 0.25 μg/side, intrahippocampal administration) increases ERK1/2 and CREB activation and facilitated LTM in rats[4].

    Actividad biológica

    1.Immobilized Human TrkB-His at 5 μg/mL (100 μl/well) can bind Human BDNF Biotinylated by NHS-biotin prior to testing. The ED50 of Human BDNF is ≤6 ng/mL.
    2.Immobilized Human TrkB-His at 2 μg/mL (100 μl/well) can bind Human BDNF Biotinylated by NHS-biotin prior to testing. The ED50 of Human BDNF is <100 ng/mL.
    3.Measured by its binding ability in a functional ELISA. When Recombinant Human BDNF is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human TrkB. The ED50 for this effect is 21.18 ng/mL.
    4.Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with TrkB. The ED50 for this effect is <2 ng/mL.

    • Measured by its binding ability in a functional ELISA. When Recombinant Human BDNF is coated at 1 μg/mL (100 μL/well) can bind Recombinant Human TrkB. The ED50 for this effect is 21.18 ng/mL.
    Species

    Mouse; Rat; Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P23560-1 (H129-R247)/P21237-1 (H131-R249)/P23363 (H131-R249)

    Gene ID

    627  [NCBI]/12064/24225

    Molecular Construction
    N-term
    BDNF (H129-R247)
    Accession # P23560
    C-term
    Protein Length

    Full Length of Isoform-1 Mature Protein

    Synonyms
    BDNF/Brain-derived neurotrophic factor; Abrineurin
    AA Sequence

    HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

    Predicted Molecular Mass
    13.5 kDa
    Peso molecular

    Approximately 14-19 kDa, based on SDS-PAGE under reducing conditions.

    Pureza
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 400 mM NaCl,pH 7.2.
    2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 0.8.
    3.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <0.01 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Envío

    Room temperature in continental US; may vary elsewhere.

    Documentación
    Referencias
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    BDNF Protein, Human/Mouse/Rat

     

    Requested Quantity *

    Nombre del solicitante *

     

    Saludo

    Direcciòn del E-mail *

     

    Número de teléfono *

    Department

     

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

         

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    BDNF Protein, Human/Mouse/Rat
    Cat. No.:
    HY-P7116A
    Cantidad:
    MCE Japan Authorized Agent: