Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His)

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

The Beta-lactamase TEM/Bla protein group stands out as the predominant class of beta-lactamases in enterobacteria, exerting their resistance mechanism by hydrolyzing the beta-lactam bond in susceptible beta-lactam antibiotics. This enzymatic activity imparts resistance specifically to penicillins and cephalosporins. Among the TEM variants, TEM-3 and TEM-4 demonstrate the ability to hydrolyze cefotaxime and ceftazidime, while TEM-5 targets ceftazidime. TEM-6 extends its hydrolyzing capability to ceftazidime and aztreonam. Notably, TEM-8/CAZ-2, TEM-16/CAZ-7, and TEM-24/CAZ-6 exhibit marked activity against ceftazidime. Additionally, IRT-4 showcases resistance to beta-lactamase inhibitors, highlighting the diverse enzymatic profiles within the TEM/Bla protein family, crucial in the context of antibiotic resistance in clinical settings.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

E.coli

P. pastoris

N-6*His

P62593 (H24-W286)

/

Full Length of Mature Protein

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Approximately 30.9 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.