Copy Link Print Information

Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The β-lactamase TEM/Bla proteome is dominant in Enterobacteriaceae and hydrolyzes β-lactam bonds in β-lactam antibiotics, thereby conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 hydrolyze cefotaxime and ceftazidime, TEM-5 targets ceftazidime, and TEM-6 includes aztreonam. Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived Beta-lactamase TEM/Bla protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

The Beta-lactamase TEM/Bla protein group stands out as the predominant class of beta-lactamases in enterobacteria, exerting their resistance mechanism by hydrolyzing the beta-lactam bond in susceptible beta-lactam antibiotics. This enzymatic activity imparts resistance specifically to penicillins and cephalosporins. Among the TEM variants, TEM-3 and TEM-4 demonstrate the ability to hydrolyze cefotaxime and ceftazidime, while TEM-5 targets ceftazidime. TEM-6 extends its hydrolyzing capability to ceftazidime and aztreonam. Notably, TEM-8/CAZ-2, TEM-16/CAZ-7, and TEM-24/CAZ-6 exhibit marked activity against ceftazidime. Additionally, IRT-4 showcases resistance to beta-lactamase inhibitors, highlighting the diverse enzymatic profiles within the TEM/Bla protein family, crucial in the context of antibiotic resistance in clinical settings.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species E.coli
  • Source P. pastoris
  • Tag N-6*His
  • Accession

    P62593 (H24-W286)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • 6*His
    • TEM-1 (H24-W286)
      Accession # P62593
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    men1; bla; Cefotaximase 1; Beta-lactamase MEN-1; EC:3.5.2.6; Beta-lactamase CTX-M-1

  • AA Sequence

    HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

  • Predicted Molecular Mass

    30.9 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) Product Image
    1/16
  • Beta-lactamase TEM/Bla Protein, E.coli (P.pastoris, His) Product Image