BRCC36 Protein, Human (His-SUMO)
Based on 1 Customer Validation
BRCC36 is a metalloprotease that selectively cleaves "Lys-63" linked polyubiquitin chains, especially histones H2A and H2AX in the BRCA1-A complex during the DNA damage response. As the catalytic subunit of the BRISC complex, it also targets “Lys-63”-linked ubiquitin in various substrates, affecting mitotic spindle assembly and interferon signaling. BRCC36 Protein, Human (His-SUMO) is the recombinant human-derived BRCC36 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
BRCC36 is a metalloprotease that selectively cleaves "Lys-63" linked polyubiquitin chains, especially histones H2A and H2AX in the BRCA1-A complex during the DNA damage response. As the catalytic subunit of the BRISC complex, it also targets “Lys-63”-linked ubiquitin in various substrates, affecting mitotic spindle assembly and interferon signaling. BRCC36 Protein, Human (His-SUMO) is the recombinant human-derived BRCC36 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
BRCC36, identified as a metalloprotease, exhibits specificity in cleaving 'Lys-63'-linked polyubiquitin chains while displaying no activity toward 'Lys-48'-linked polyubiquitin chains. As a crucial component of the BRCA1-A complex, BRCC36 participates in DNA damage response by recognizing 'Lys-63'-linked ubiquitinated histones H2A and H2AX at sites of double-strand breaks. Within this complex, BRCC36 selectively removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX, opposing the RNF8-dependent ubiquitination at double-strand breaks. Additionally, BRCC36 serves as the catalytic subunit of the BRISC complex, another multiprotein assembly dedicated to cleaving 'Lys-63'-linked ubiquitin in various substrates. The BRISC complex's involvement in mitotic spindle assembly and microtubule attachment to kinetochores, mediated by the deubiquitination of NUMA1, underscores its regulatory role in cell division. BRCC36 also contributes to interferon signaling through deubiquitination of the interferon receptor IFNAR1, enhancing its stability and cell surface expression. Furthermore, BRCC36 plays a role in regulating the NLRP3 inflammasome by mediating deubiquitination of NLRP3, leading to inflammasome assembly, and down-regulates the response to bacterial lipopolysaccharide by participating in IFNAR1 deubiquitination. In its repertoire, BRCC36 deubiquitinates HDAC1 and PWWP2B, contributing to their stabilization.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P46736 (A2-E316)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
BRCC36 (A2-E316)
Accession # P46736 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
BRCC3; Lys-63-Specific Deubiquitinase BRCC36; Prev. CXorf53; BRCA1-A Complex Subunit BRCC36; BRCC36; BRISC Complex Subunit BRCC36; C6.1A; BRCA1/BRCA2-Containing Complex, Subunit 3; BRCA1/BRCA2-Containing Complex Subunit 36; Chromosome X Open Reading Frame
-
AA Sequence
AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE
-
Predicted Molecular Mass
51.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)