1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. BRCC36 Protein, Human (His-SUMO)

BRCC36 Protein, Human (His-SUMO)

Cat. No.: HY-P72107
COA Handling Instructions

BRCC36 is a metalloprotease that selectively cleaves "Lys-63" linked polyubiquitin chains, especially histones H2A and H2AX in the BRCA1-A complex during the DNA damage response. As the catalytic subunit of the BRISC complex, it also targets “Lys-63”-linked ubiquitin in various substrates, affecting mitotic spindle assembly and interferon signaling. BRCC36 Protein, Human (His-SUMO) is the recombinant human-derived BRCC36 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of BRCC36 Protein, Human (His-SUMO) is 315 a.a., with molecular weight of ~51.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $160 In-stock
50 μg $450 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BRCC36 is a metalloprotease that selectively cleaves "Lys-63" linked polyubiquitin chains, especially histones H2A and H2AX in the BRCA1-A complex during the DNA damage response. As the catalytic subunit of the BRISC complex, it also targets “Lys-63”-linked ubiquitin in various substrates, affecting mitotic spindle assembly and interferon signaling. BRCC36 Protein, Human (His-SUMO) is the recombinant human-derived BRCC36 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of BRCC36 Protein, Human (His-SUMO) is 315 a.a., with molecular weight of ~51.9 kDa.

Background

BRCC36, identified as a metalloprotease, exhibits specificity in cleaving 'Lys-63'-linked polyubiquitin chains while displaying no activity toward 'Lys-48'-linked polyubiquitin chains. As a crucial component of the BRCA1-A complex, BRCC36 participates in DNA damage response by recognizing 'Lys-63'-linked ubiquitinated histones H2A and H2AX at sites of double-strand breaks. Within this complex, BRCC36 selectively removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX, opposing the RNF8-dependent ubiquitination at double-strand breaks. Additionally, BRCC36 serves as the catalytic subunit of the BRISC complex, another multiprotein assembly dedicated to cleaving 'Lys-63'-linked ubiquitin in various substrates. The BRISC complex's involvement in mitotic spindle assembly and microtubule attachment to kinetochores, mediated by the deubiquitination of NUMA1, underscores its regulatory role in cell division. BRCC36 also contributes to interferon signaling through deubiquitination of the interferon receptor IFNAR1, enhancing its stability and cell surface expression. Furthermore, BRCC36 plays a role in regulating the NLRP3 inflammasome by mediating deubiquitination of NLRP3, leading to inflammasome assembly, and down-regulates the response to bacterial lipopolysaccharide by participating in IFNAR1 deubiquitination. In its repertoire, BRCC36 deubiquitinates HDAC1 and PWWP2B, contributing to their stabilization.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P46736 (A2-E316)

Gene ID
Molecular Construction
N-term
6*His-SUMO
BRCC36 (A2-E316)
Accession # P46736
C-term
Synonyms
BRCA1-A complex subunit BRCC36; BRCA1/BRCA2 containing complex subunit 3; BRCA1/BRCA2 containing complex subunit 36; BRCA1/BRCA2-containing complex subunit 3; BRCA1/BRCA2-containing complex subunit 36; Brcc3; BRCC3_HUMAN; BRCC36; BRISC complex subunit BRCC36; C6.1A ; Chromosome X open reading frame 53; CXorf53; Lys-63-specific deubiquitinase BRCC36; OTTHUMP00000061450
AA Sequence

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

Molecular Weight

Approximately 51.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BRCC36 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BRCC36 Protein, Human (His-SUMO)
Cat. No.:
HY-P72107
Quantity:
MCE Japan Authorized Agent: