Brorin/VWC2 Protein, Human (HEK293, His)

The Brorin/VWC2 protein is a bone morphogenetic protein antagonist that promotes cell adhesion and associates peripherally with the AMPAR complex, a key player in synaptic transmission. In the AMPAR complex, Brorin/VWC2 and various proteins (such as CNIH2, CNIH3, CACNG2, etc.) together form a complex structure. Brorin/VWC2 Protein, Human (HEK293, His) is the recombinant human-derived Brorin/VWC2 protein, expressed by HEK293 , with C-His labeled tag.

Brorin/VWC2 Protein, a bone morphogenetic protein (BMP) antagonist, is implicated in neural development and functions as a promoter of cell adhesion. It is peripherally associated with the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) complex, a critical player in synaptic transmission. The AMPAR complex consists of an inner core comprising pore-forming GluA/GRIA proteins and major auxiliary subunits arranged in a twofold symmetry. Brorin/VWC2, serving as one of the peripherally associated constituents, contributes to the intricate architecture of the AMPAR complex. This complex includes various proteins like CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG8, GSG1L, PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L, and NRN1, among others. Together, these proteins form a platform that regulates the gating, pharmacology, biogenesis, and protein processing of the AMPAR complex, thereby influencing synaptic function and plasticity.

Measured by its binding ability in a functional ELISA. When Recombinant Human Brorin/VWC2 is coated at 10 µg/mL can bind Biotinylated Human BMP-6 (HY-P700029AF). The ED₅₀ for this effect is 4.2 µg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human Brorin/VWC2 is coated at 10 µg/mL can bind Biotinylated Human BMP-6 (HY-P700029AF). The ED₅₀ for this effect is 4.2 µg/mL.

Human

HEK293

C-6*His

Q2TAL6 (S28-M325)

375567  [NCBI]

Full Length of Mature Protein

SPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM

Approximately 44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.