CADM3 Protein, Mouse (HEK293, His)

CADM3 protein plays a key role in cell-cell adhesion and is involved in a series of adhesion activities. It forms calcium-independent homophilic and heterophilic interactions with IGSF4, NECTIN1 and NECTIN3, demonstrating its versatility. CADM3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.

CADM3, a pivotal player in cell-cell adhesion, engages in a spectrum of adhesive activities. It encompasses both calcium-independent homophilic cell-cell adhesion and calcium-independent heterophilic cell-cell adhesion with IGSF4, NECTIN1, and NECTIN3, showcasing its versatility in mediating various cell interactions. The interaction with EPB41L1 suggests a potential role in modulating the structure or function of cell-cell junctions, adding an additional layer of complexity to its functional repertoire. Existing as a homodimer, CADM3 also has the capability to form trans-heterodimers with NECTIN3, underlining its dynamic role in adhesive interactions. Moreover, CADM3 interacts with EPB41L1, DLG3, PALS2, and CASK, further emphasizing its involvement in intricate cellular signaling and junction dynamics. This multifaceted engagement positions CADM3 as a key regulator in the realm of cell adhesion and intercellular communication.

Mouse

HEK293

C-His

Q99N28 (N23-H328)

94332  [NCBI]

Extracellular Domain

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVSSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKETATLNCQSSGSKPAAQLTWRKGDQELHGDQTRIQEDPNGKTFTVSSSVSFQVTREDDGANIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPEPAHPREGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYTAYFTLNVNDPSPVPSSSSTYH

Approximately 37-42 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.