1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Cell Adhesion Molecule 3 (CADM3)
  6. CADM3 Protein, Mouse (HEK293, His)

CADM3 protein plays a key role in cell-cell adhesion and is involved in a series of adhesion activities. It forms calcium-independent homophilic and heterophilic interactions with IGSF4, NECTIN1 and NECTIN3, demonstrating its versatility. CADM3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CADM3 protein plays a key role in cell-cell adhesion and is involved in a series of adhesion activities. It forms calcium-independent homophilic and heterophilic interactions with IGSF4, NECTIN1 and NECTIN3, demonstrating its versatility. CADM3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.

Background

CADM3, a pivotal player in cell-cell adhesion, engages in a spectrum of adhesive activities. It encompasses both calcium-independent homophilic cell-cell adhesion and calcium-independent heterophilic cell-cell adhesion with IGSF4, NECTIN1, and NECTIN3, showcasing its versatility in mediating various cell interactions. The interaction with EPB41L1 suggests a potential role in modulating the structure or function of cell-cell junctions, adding an additional layer of complexity to its functional repertoire. Existing as a homodimer, CADM3 also has the capability to form trans-heterodimers with NECTIN3, underlining its dynamic role in adhesive interactions. Moreover, CADM3 interacts with EPB41L1, DLG3, PALS2, and CASK, further emphasizing its involvement in intricate cellular signaling and junction dynamics. This multifaceted engagement positions CADM3 as a key regulator in the realm of cell adhesion and intercellular communication.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q99N28 (N23-H328)

Gene ID
Molecular Construction
N-term
CADM3 (N23-H328)
Accession # Q99N28
His
C-term
Protein Length

Extracellular Domain

Synonyms
Cell adhesion molecule 3; IgSF4B; NECL-1; Syncam3
AA Sequence

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVSSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKETATLNCQSSGSKPAAQLTWRKGDQELHGDQTRIQEDPNGKTFTVSSSVSFQVTREDDGANIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPEPAHPREGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYTAYFTLNVNDPSPVPSSSSTYH

Predicted Molecular Mass
35 kDa
Molecular Weight

Approximately 37-42 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CADM3 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CADM3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76756
Quantity:
MCE Japan Authorized Agent: