Calcineurin A/PPP3CA Protein, Human (sf9, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The calcineurin A/PPP3CA protein is a calcium-dependent, calmodulin-stimulated phosphatase. PPP3CA inhibits MAP3K14/NIK signaling and SLC9A1 activity. PPP3CA is involved in processes such as kidney development, salivary enzyme secretion, hippocampal homosynaptic depotentiation, keratinocyte survival, bone formation, and T cell proliferation. Calcineurin A/PPP3CA Protein, Human (sf9, His) is the recombinant human-derived Calcineurin A/PPP3CA protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The calcineurin A/PPP3CA protein is a calcium-dependent, calmodulin-stimulated phosphatase. PPP3CA inhibits MAP3K14/NIK signaling and SLC9A1 activity. PPP3CA is involved in processes such as kidney development, salivary enzyme secretion, hippocampal homosynaptic depotentiation, keratinocyte survival, bone formation, and T cell proliferation. Calcineurin A/PPP3CA Protein, Human (sf9, His) is the recombinant human-derived Calcineurin A/PPP3CA protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

Calcineurin A, also known as PPP3CA, is a calcium-dependent, calmodulin-stimulated protein phosphatase that plays a pivotal role in transducing intracellular Ca(2+)-mediated signals. Known substrates often contain a PxIxIT motif and/or an LxVP motif, highlighting the specificity of its phosphatase activity. In response to elevated Ca(2+) levels, Calcineurin A dephosphorylates and activates phosphatase SSH1, leading to cofilin dephosphorylation. Furthermore, upon increased Ca(2+) levels following mitochondrial depolarization, Calcineurin A dephosphorylates DNM1L, inducing its translocation to the mitochondrion. The protein also positively regulates CACNA1B/CAV2.2-mediated Ca(2+) release probability at hippocampal neuronal soma and synaptic terminals. Calcineurin A dephosphorylates and activates transcription factor NFATC1, thereby regulating NFAT-mediated transcription by promoting nuclear translocation. Its broad array of functions includes the dephosphorylation of heat shock protein HSPB1, transcription factor ELK1, DARPP32, CRTC2, TFEB, and KLHL3, suggesting a crucial role in various cellular processes such as kidney development, secretion of salivary enzymes, bone formation, immune responses, and regulation of ion transport. The multifaceted roles of Calcineurin A underscore its significance in diverse cellular functions and signal transduction pathways.

Verified Bioactivity

1.The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
2.Using the Octet RED System, the affinity constant (Kd) of human PPPP3CA-His bound to Human PPIA-His was 0.9 nM.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • PPP3CA (S2-Q521)
      Accession # Q08209-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PPP3CA; Protein Phosphatase 2B, Catalytic Subunit, Alpha Isoform; Prev. CALNA; Protein Phosphatase 3, Catalytic Subunit, Alpha Isozyme; Prev. CALN; Protein Phosphatase 3 Catalytic Subunit Alpha Isozyme; Calcineurin A Alpha; Serine/Threonine-Protein Phosph

  • AA Sequence

    SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ

  • Predicted Molecular Mass

    60.8 kDa

  • Molecular Weight

    Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00