Calcineurin A/PPP3CA Protein, Human (sf9, His)
Based on 1 publication(s) in Google Scholar
The calcineurin A/PPP3CA protein is a calcium-dependent, calmodulin-stimulated phosphatase. PPP3CA inhibits MAP3K14/NIK signaling and SLC9A1 activity. PPP3CA is involved in processes such as kidney development, salivary enzyme secretion, hippocampal homosynaptic depotentiation, keratinocyte survival, bone formation, and T cell proliferation. Calcineurin A/PPP3CA Protein, Human (sf9, His) is the recombinant human-derived Calcineurin A/PPP3CA protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The calcineurin A/PPP3CA protein is a calcium-dependent, calmodulin-stimulated phosphatase. PPP3CA inhibits MAP3K14/NIK signaling and SLC9A1 activity. PPP3CA is involved in processes such as kidney development, salivary enzyme secretion, hippocampal homosynaptic depotentiation, keratinocyte survival, bone formation, and T cell proliferation. Calcineurin A/PPP3CA Protein, Human (sf9, His) is the recombinant human-derived Calcineurin A/PPP3CA protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
Calcineurin A, also known as PPP3CA, is a calcium-dependent, calmodulin-stimulated protein phosphatase that plays a pivotal role in transducing intracellular Ca(2+)-mediated signals. Known substrates often contain a PxIxIT motif and/or an LxVP motif, highlighting the specificity of its phosphatase activity. In response to elevated Ca(2+) levels, Calcineurin A dephosphorylates and activates phosphatase SSH1, leading to cofilin dephosphorylation. Furthermore, upon increased Ca(2+) levels following mitochondrial depolarization, Calcineurin A dephosphorylates DNM1L, inducing its translocation to the mitochondrion. The protein also positively regulates CACNA1B/CAV2.2-mediated Ca(2+) release probability at hippocampal neuronal soma and synaptic terminals. Calcineurin A dephosphorylates and activates transcription factor NFATC1, thereby regulating NFAT-mediated transcription by promoting nuclear translocation. Its broad array of functions includes the dephosphorylation of heat shock protein HSPB1, transcription factor ELK1, DARPP32, CRTC2, TFEB, and KLHL3, suggesting a crucial role in various cellular processes such as kidney development, secretion of salivary enzymes, bone formation, immune responses, and regulation of ion transport. The multifaceted roles of Calcineurin A underscore its significance in diverse cellular functions and signal transduction pathways.
Verified Bioactivity
1.The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
2.Using the Octet RED System, the affinity constant (Kd) of human PPPP3CA-His bound to Human PPIA-His was 0.9 nM.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Carbohydr Res
A structurally defined galactoglucan from Arisaema erubescens with a multi-target tumor-associated protein binding domain. [Abstract]2025 Nov 29:560:109781. PMID: 41344200
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
Q08209-1 (S2-Q521)
-
Molecular Construction
-
N-term
-
His
-
PPP3CA (S2-Q521)
Accession # Q08209-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PPP3CA; Protein Phosphatase 2B, Catalytic Subunit, Alpha Isoform; Prev. CALNA; Protein Phosphatase 3, Catalytic Subunit, Alpha Isozyme; Prev. CALN; Protein Phosphatase 3 Catalytic Subunit Alpha Isozyme; Calcineurin A Alpha; Serine/Threonine-Protein Phosph
-
AA Sequence
SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
-
Predicted Molecular Mass
60.8 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)