1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Phosphatase
  4. Serine/Threonine Phosphatase
  5. Calcineurin A alpha
  6. Calcineurin A/PPP3CA Protein, Human (sf9, His)

The calcineurin A/PPP3CA protein is a calcium-dependent, calmodulin-stimulated phosphatase. PPP3CA inhibits MAP3K14/NIK signaling and SLC9A1 activity. PPP3CA is involved in processes such as kidney development, salivary enzyme secretion, hippocampal homosynaptic depotentiation, keratinocyte survival, bone formation, and T cell proliferation. Calcineurin A/PPP3CA Protein, Human (sf9, His) is the recombinant human-derived Calcineurin A/PPP3CA protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Calcineurin A/PPP3CA Protein, Human (sf9, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The calcineurin A/PPP3CA protein is a calcium-dependent, calmodulin-stimulated phosphatase. PPP3CA inhibits MAP3K14/NIK signaling and SLC9A1 activity. PPP3CA is involved in processes such as kidney development, salivary enzyme secretion, hippocampal homosynaptic depotentiation, keratinocyte survival, bone formation, and T cell proliferation. Calcineurin A/PPP3CA Protein, Human (sf9, His) is the recombinant human-derived Calcineurin A/PPP3CA protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

Calcineurin A, also known as PPP3CA, is a calcium-dependent, calmodulin-stimulated protein phosphatase that plays a pivotal role in transducing intracellular Ca(2+)-mediated signals. Known substrates often contain a PxIxIT motif and/or an LxVP motif, highlighting the specificity of its phosphatase activity. In response to elevated Ca(2+) levels, Calcineurin A dephosphorylates and activates phosphatase SSH1, leading to cofilin dephosphorylation. Furthermore, upon increased Ca(2+) levels following mitochondrial depolarization, Calcineurin A dephosphorylates DNM1L, inducing its translocation to the mitochondrion. The protein also positively regulates CACNA1B/CAV2.2-mediated Ca(2+) release probability at hippocampal neuronal soma and synaptic terminals. Calcineurin A dephosphorylates and activates transcription factor NFATC1, thereby regulating NFAT-mediated transcription by promoting nuclear translocation. Its broad array of functions includes the dephosphorylation of heat shock protein HSPB1, transcription factor ELK1, DARPP32, CRTC2, TFEB, and KLHL3, suggesting a crucial role in various cellular processes such as kidney development, secretion of salivary enzymes, bone formation, immune responses, and regulation of ion transport. The multifaceted roles of Calcineurin A underscore its significance in diverse cellular functions and signal transduction pathways.

Biological Activity

1.The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
2.Using the Octet RED System, the affinity constant (Kd) of human PPPP3CA-His bound to Human PPIA-His was 0.9 nM.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

Q08209-1 (S2-Q521)

Gene ID
Molecular Construction
N-term
His
PPP3CA (S2-Q521)
Accession # Q08209-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform; CALNA; CNA
AA Sequence

SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ

Molecular Weight

Approximately 60 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Calcineurin A/PPP3CA Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Calcineurin A/PPP3CA Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calcineurin A/PPP3CA Protein, Human (sf9, His)
Cat. No.:
HY-P76759
Quantity:
MCE Japan Authorized Agent: