Cathepsin D Protein, Cricetulus griseus (His-SUMO)

Cathepsin D is an intracellular aspartic protease of the pepsin superfamily. Cathepsin D is synthesized on the rough endoplasmic reticulum as a pre-pro-enzyme. Cathepsin D is sorted to the lysosomal compartments mainly by M-6-P pathway. Cathepsin D Protein, Cricetulus griseus (His-SUMO) is the recombinant Cathepsin D protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of Cathepsin D Protein, Cricetulus griseus (His-SUMO) is 344 a.a., with molecular weight of ~53.3 kDa.

Cathepsin D is over-expressed and hyper-secreted by epithelial breast cancer cells. Cathepsin D is an independent marker of poor prognosis in breast cancer. Cathepsin D is also a key mediator of induced-apoptosis and its proteolytic activity has been involved generally in this event^[1].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Others

E. coli

N-6*His;N-SUMO

G3I4W7 (G65-L408)

100766628  [NCBI]

GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL

Approximately 53.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.