Copy Link Print Information

Cathepsin D Protein, Cricetulus griseus (His-SUMO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Cathepsin D is an intracellular aspartic protease of the pepsin superfamily. Cathepsin D is synthesized on the rough endoplasmic reticulum as a pre-pro-enzyme. Cathepsin D is sorted to the lysosomal compartments mainly by M-6-P pathway. Cathepsin D Protein, Cricetulus griseus (His-SUMO) is the recombinant Cathepsin D protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Cathepsin D Protein, Cricetulus griseus (His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Cathepsin D is an intracellular aspartic protease of the pepsin superfamily. Cathepsin D is synthesized on the rough endoplasmic reticulum as a pre-pro-enzyme. Cathepsin D is sorted to the lysosomal compartments mainly by M-6-P pathway. Cathepsin D Protein, Cricetulus griseus (His-SUMO) is the recombinant Cathepsin D protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

Cathepsin D is over-expressed and hyper-secreted by epithelial breast cancer cells. Cathepsin D is an independent marker of poor prognosis in breast cancer. Cathepsin D is also a key mediator of induced-apoptosis and its proteolytic activity has been involved generally in this event[1].

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession

    G3I4W7 (G65-L408)

  • Gene ID
    100766628  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • Cathepsin D (G65-L408)
      Accession # G3I4W7
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CTSD; Cathepsin D (Lysosomal Aspartyl Protease); Prev. CPSD; Lysosomal Aspartyl Protease; CLN10; Cathepsin D Isoform 2; Ceroid-Lipofuscinosis, Neuronal 10; HEL-S-130P; Epididymis Secretory Sperm Binding Protein Li 130P; Cathepsin D; Lysosomal Aspartyl Pep

  • AA Sequence

    GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL

  • Predicted Molecular Mass

    53.3 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Cathepsin D Protein, Cricetulus griseus (His-SUMO) Product Image
    1/16
  • Cathepsin D Protein, Cricetulus griseus (His-SUMO) Product Image