1. Recombinant Proteins
  2. Cathepsin D Protein, Human (HEK293, His)

Cathepsin D Protein, Human (HEK293, His)

Cat. No.: HY-P7748
Handling Instructions

Cathepsin D Protein, Human (HEK293, His) is an approximately 50.0 kDa cathepsin D protein with a His-flag. Cathepsin D is a representative lysosomal aspartic proteinases and belongs to the peptidase C1 family[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $496 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuCathepsin D, His; Cathepsin D; CTSD; CPSD
Species

Human

Source

HEK 293

Accession

P07339 (L21-L412)

Gene ID

1509

Molecular Weight

Approximately 50.0 kDa

AA Sequence

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Cathepsin D (CTSD), a well-known lysosomal aspartyl protease and belongs to the peptidase C1 family, which is a normal and major component of lysosomes, and is found in almost all cells and tissues of mammals[1].
Human cathepsin D is synthesized as a precursor protein, consisting of a signal peptide (residues 1-18), a propeptide (residues 1964), and a mature chain (residues (65412))[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin D Protein, Human (HEK293, His)
Cat. No.:
HY-P7748
Quantity:
MCE Japan Authorized Agent: