1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin D
  5. Cathepsin D Protein, Human (HEK293, His)

Cathepsin D Protein, Human (HEK293, His)

Cat. No.: HY-P7748
COA Handling Instructions

Cathepsin D Protein, Human (HEK293, His) is an approximately 50.0 kDa cathepsin D protein with a His-flag. Cathepsin D is a representative lysosomal aspartic proteinases and belongs to the peptidase C1 family.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $165 In-stock
50 μg $496 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Cathepsin D Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cathepsin D Protein, Human (HEK293, His) is an approximately 50.0 kDa cathepsin D protein with a His-flag. Cathepsin D is a representative lysosomal aspartic proteinases and belongs to the peptidase C1 family[1].

Background

Cathepsin D (CTSD), a well-known lysosomal aspartyl protease and belongs to the peptidase C1 family, which is a normal and major component of lysosomes, and is found in almost all cells and tissues of mammals[1].
Human cathepsin D is synthesized as a precursor protein, consisting of a signal peptide (residues 1-18), a propeptide (residues 1964), and a mature chain (residues (65412))[2].

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is >600 pmol/min/µg, as measured under the described conditions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P07339 (L21-L412)

Gene ID
Molecular Construction
N-term
Cathepsin D (L21-L412)
Accession # P07339
6*His
C-term
Synonyms
rHuCathepsin D, His; Cathepsin D; CTSD; CPSD
AA Sequence

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH

Molecular Weight

Approximately 50.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filter solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Cathepsin D Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin D Protein, Human (HEK293, His)
Cat. No.:
HY-P7748
Quantity:
MCE Japan Authorized Agent: