Copy Link Print Information

Cathepsin E Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Cathepsin E Protein, Human (HEK293, His) is a human cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases..

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Cathepsin E Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Cathepsin E Protein, Human (HEK293, His) is a human cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.[1].

Background

Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases. As an intracellular, hydrolytic aspartic protease, Cathepsin E is mainly expressed in cells of the immune and gastrointestinal systems, lymphoid tissues, erythrocytes, and cancer cells[1].
Cathepsin E functions by breaking down proteins through the hydrolysis of peptide bonds at a specific peptide sequence site. And Cathepsin E plays an important role in the degradation of proteins, the generation of bioactive proteins, and antigen processing[2].
Human Cathepsin E is synthesized as a precursor protein, consisting of a signal peptide (residues 117), a propeptide (residues 1853), and a mature chain (residues 54396)[3].

Verified Bioactivity

Measured by its ability to cleave 40μM fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2 that incubated at room temperature for 30min. The specific activity is 14784.79 pmol/min/ug. (Activation description: The proenzyme needs to be activated in acid reducing buffer for an activated form.)

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P14091 (S20-P396)

  • Gene ID
    1510  [NCBI]
  • Molecular Construction
    • N-term
    • Cathepsin E (S20-P396)
      Accession # P14091
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein (with Propeptide)

  • Synonyms

    CTSE; Slow-Moving Proteinase; Cathepsin E; CATE; Erythrocyte Membrane Aspartic Proteinase

  • AA Sequence

    SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP

  • Predicted Molecular Mass

    41.8 kDa

  • Molecular Weight

    Approximately 43-47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells [Content Brief]

[2]. F Grüninger-Leitch, et al. Identification of beta-secretase-like activity using a mass spectrometry-based assay system. Nat Biotechnol. 2000 Jan;18(1):66-70. [Content Brief]

[3]. T Azuma, et al. Human gastric cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases. J Biol Chem [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Cathepsin E Protein, Human (HEK293, His) Product Image
    1/16
  • Cathepsin E Protein, Human (HEK293, His) Product Image