1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin E
  5. Cathepsin E Protein, Human (HEK293, His)

Cathepsin E Protein, Human (HEK293, His)

Cat. No.: HY-P7750
COA Handling Instructions

Cathepsin E Protein, Human (HEK293, His) is an approximately 46.0 kDa mouse cathepsin Dwith a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases..

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $145 In-stock
50 μg $400 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cathepsin E Protein, Human (HEK293, His) is an approximately 46.0 kDa mouse cathepsin Dwith a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.[1].

Background

Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases. As an intracellular, hydrolytic aspartic protease, Cathepsin E is mainly expressed in cells of the immune and gastrointestinal systems, lymphoid tissues, erythrocytes, and cancer cells[1].
Cathepsin E functions by breaking down proteins through the hydrolysis of peptide bonds at a specific peptide sequence site. And Cathepsin E plays an important role in the degradation of proteins, the generation of bioactive proteins, and antigen processing[2].
Human Cathepsin E is synthesized as a precursor protein, consisting of a signal peptide (residues 117), a propeptide (residues 1853), and a mature chain (residues 54396)[3].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P14091 (S20-P396)

Gene ID
Synonyms
rHuCathepsin E, His; Cathepsin E; CTSE
AA Sequence

SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPHHHHHH

Molecular Weight

Approximately 42-48 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.    

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Cathepsin E Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin E Protein, Human (HEK293, His)
Cat. No.:
HY-P7750
Quantity:
MCE Japan Authorized Agent: