Cathepsin K Protein, Rat (His)
Based on 1 Customer Validation
Cathepsin K protein is a thiol protease that is essential for osteoclastic bone resorption and regulation of bone remodeling. It exhibits potent endoprotease activity against fibrinogen under acidic conditions, suggesting its role in extracellular matrix degradation. Cathepsin K Protein, Rat (His) is the recombinant rat-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cathepsin K protein is a thiol protease that is essential for osteoclastic bone resorption and regulation of bone remodeling. It exhibits potent endoprotease activity against fibrinogen under acidic conditions, suggesting its role in extracellular matrix degradation. Cathepsin K Protein, Rat (His) is the recombinant rat-derived Cathepsin K protein, expressed by E. coli , with N-6*His labeled tag.
Background
Cathepsin K Protein, a thiol protease, plays a crucial role in osteoclastic bone resorption and is implicated in the regulation of bone remodeling. It exhibits potent endoprotease activity against fibrinogen under acidic conditions, suggesting its involvement in extracellular matrix degradation. Additionally, Cathepsin K is involved in the release of thyroid hormone thyroxine (T4) through limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen. This multifaceted functionality underscores its significance in both bone metabolism and thyroid hormone regulation, emphasizing its role in maintaining the delicate balance of these physiological processes.
Verified Bioactivity
One unit is defined as the amount of enzyme that will hydrolyze 1 μmol Z-Phe-Arg-AMC substrate per min at 37°C. The activity is 0.06113 U/mg.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-6*His
-
Accession
O35186 (V115-M329)
-
Molecular Construction
-
N-term
-
6*His
-
Cathepsin K (V115-M329)
Accession # O35186 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CTSK; Cathepsin X; Prev. CTSO2; Mutated Cathepsin K; Prev. CTSO; Cathepsin O1; Prev. PYCD; CTSK Protein; PKND; CTS02; Cathepsin O2; CTSO1; Cathepsin O; Cathepsin K; Cathepsin K (Pycnodysostosis)
-
AA Sequence
VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGESWGNKGYVLLARNKNNACGITNLASFPKM
-
Predicted Molecular Mass
27.5 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
