Cathepsin W/CTSW, Mouse (His, myc)

Cathepsin W/CTSW is implicated in potentially regulating T-cell cytolytic activity, suggesting a role in immune response processes. Recognizing its potential function underscores its significance in immune defense against pathogens. The precise mechanisms of Cathepsin W in T-cell regulation remain an area of interest, highlighting its potential as a key player in immune system function and cellular defense orchestration. Cathepsin W/CTSW, Mouse (His, myc) is the recombinant mouse-derived Cathepsin W/CTSW, expressed by E. coli , with C-Myc, N-10*His labeled tag. The total length of Cathepsin W/CTSW, Mouse (His, myc) is 246 a.a., with molecular weight of ~35.2 kDa.

Cathepsin W/CTSW is implicated in potentially having a specific role in the mechanism or regulation of T-cell cytolytic activity, suggesting its involvement in the intricate processes governing the immune response. The recognition of its potential function in T-cell cytolytic activity underscores its significance in the immune system's defense against pathogens and abnormal cells. The precise mechanisms by which Cathepsin W operates in the regulation of T-cell activity remain an area of interest, highlighting its potential as a key player in immune system function and the orchestration of cellular defense mechanisms.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

E. coli

C-Myc;N-10*His

P56203 (V126-P371)

13041  [NCBI]

VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP

Approximately 35.2 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<14 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.