Cathepsin W/CTSW Protein, Mouse (His, Myc)
Cathepsin W/CTSW is implicated in potentially regulating T-cell cytolytic activity, suggesting a role in immune response processes. Recognizing its potential function underscores its significance in immune defense against pathogens. The precise mechanisms of Cathepsin W in T-cell regulation remain an area of interest, highlighting its potential as a key player in immune system function and cellular defense orchestration. Cathepsin W/CTSW Protein, Mouse (His, myc) is the recombinant mouse-derived Cathepsin W/CTSW, expressed by E. coli , with C-Myc, N-10*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cathepsin W/CTSW is implicated in potentially regulating T-cell cytolytic activity, suggesting a role in immune response processes. Recognizing its potential function underscores its significance in immune defense against pathogens. The precise mechanisms of Cathepsin W in T-cell regulation remain an area of interest, highlighting its potential as a key player in immune system function and cellular defense orchestration. Cathepsin W/CTSW Protein, Mouse (His, myc) is the recombinant mouse-derived Cathepsin W/CTSW, expressed by E. coli , with C-Myc, N-10*His labeled tag.
Background
Cathepsin W/CTSW is implicated in potentially having a specific role in the mechanism or regulation of T-cell cytolytic activity, suggesting its involvement in the intricate processes governing the immune response. The recognition of its potential function in T-cell cytolytic activity underscores its significance in the immune system's defense against pathogens and abnormal cells. The precise mechanisms by which Cathepsin W operates in the regulation of T-cell activity remain an area of interest, highlighting its potential as a key player in immune system function and the orchestration of cellular defense mechanisms.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-Myc;N-10*His
-
Accession
P56203 (V126-P371)
-
Molecular Construction
-
N-term
-
10*His
-
CTSW (V126-P371)
Accession # P56203 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CTSW; Cathepsin W (Lymphopain); Cathepsin W; LYPN; Lymphopain
-
AA Sequence
VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP
-
Predicted Molecular Mass
35.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<14 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
