1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC chemokine subfamily
  5. CCL6 Protein, Mouse

CCL6 Protein, Mouse

Cat. No.: HY-P7143
Handling Instructions

CCL6 Protein, Mouse, a CC chemokine, plays a role in chronic inflammation associated with macrophage infiltration.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

CCL6 Protein, Mouse Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P27784 (G22-A116)

Gene ID

20305

Synonyms
rMuCCL6; C-C motif chemokine 6; Scya6; C10
AA Sequence

GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

Molecular Weight

Approximately 10.7 kDa

Biological Activity
Full biological activity determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-100 ng/ml.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM Tris, pH 8.0, 500 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

C10/CCL6 shares significant homology with other chemokines, including human MIP-1γ, CC chemokine F-18 (CCF-18), hemofiltrate CC chemokine (HCC-1), and HCC-2[1]. CCL6 is present in a variety of chronic inflammatory disorders including experimental demyelinating diseases, allergic airway inflammation, bleomycin-induced lung fibrosis and chronic peritonitis. CCL6 also can be used as a monocyte chemoattractant in a murine acute peritonitis[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL6 Protein, Mouse
Cat. No.:
HY-P7143
Quantity:
MCE Japan Authorized Agent: