CCL6 Protein, Mouse

CCL6 Protein, Mouse is a CC chemokine found only in rodents and is associated with macrophage infiltration in chronic inflammation as well as a role in tumorigenesis. CCL6 Protein, Mouse is a recombinant mouse CCL6 (G22-A116) expressed by E. coli^[1].

CCL6, belongs to the CC family of chemokines is located in mouse chromosome 11. CCL6 can be expressed in cells of the neutrophil and macrophage lineage in mice and can be induced in large numbers under conditions suitable for bone marrow cell differentiation. C10/CCL6 shares significant homology with other chemokines, including human MIP-1γ, CC chemokine F-18 (CCF-18), hemofiltrate CC chemokine (HCC-1), and HCC-2^[1].  CCL6 is present in a variety of chronic inflammatory disorders including experimental demyelinating diseases, allergic airway inflammation, bleomycin-induced lung fibrosis and chronic peritonitis. CCL6 also can be used as a monocyte chemoattractant in a murine acute peritonitis^[2].

CCL6 (100 -200 ng/mL) can cause concentration-dependent migration of murine ID8 cell lines and can induce migration through activation of ERK and PI3-kinase pathways, thereby enhancing downstream signaling through MYO9A and p-Cofilin^[3].

Full biological activity determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-405 ng/mL.

• 
  Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CCR1. The ED₅₀ for this effect is 404.9 ng/mL, corresponding to a specific activity is 2.470×10³ U/mg.

Mouse

E. coli

Tag Free

P27784 (G22-A116)

20305  [NCBI]

Full Length of Mature Protein

GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Bing Ma, et al. The C10/CCL6 chemokine and CCR1 play critical roles in the pathogenesis of IL-13-induced inflammation and remodeling. J Immunol. 2004 Feb 1;172(3):1872-81.  [Content Brief]

  [2]. Andrew M LaFleur, et al. Role of CC chemokine CCL6/C10 as a monocyte chemoattractant in a murine acute peritonitis. Mediators Inflamm. 2004 Dec;13(5-6):349-55.  [Content Brief]

  [3]. Venkatesh Krishnan, et al. Omental macrophages secrete chemokine ligands that promote ovarian cancer colonization of the omentum via CCR1. Commun Biol. 2020 Sep 22;3(1):524.  [Content Brief]