CD14 Protein, Mouse (HEK293, His-Fc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-hFc, C-His, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-hFc, C-His, C-6*His labeled tag.

Background

CD14 encodes a protein pivotal in the innate immune response and prominently expressed in monocyte/macrophage cells. Functioning as a co-receptor, it binds various microbial and fungal molecules, including lipopolysaccharides (LPS). The LPS-binding activity of this protein is potentiated by the LPS binding protein (LBP), facilitating binding to the TLR4-MD-2 co-receptor complex. CD14 exists in two forms—soluble and cell surface-anchored by a glycosylphosphatidylinositol anchor. Its broad expression is observed across diverse tissues, such as the mammary gland and colon, highlighting its crucial role in immune-related processes.

Verified Bioactivity

Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL-2 cells. The ED50 this effect is 468.3 ng/mL, corresponding to a specific activity is 2135.38 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL -2 cells. The ED50 this effect is 468.3 ng/mL, corresponding to a specific activity is 2135.38 U/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc;C-His;C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD14 (S16-P345)
      Accession # P10810/NP_033971.1
    • hFc-6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD14; Monocyte Differentiation Antigen CD14; CD14 Molecule; CD14 Antigen; Myeloid Cell-Specific Leucine-Rich Glycoprotein; My23 Antigen

  • AA Sequence

    SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP

  • Molecular Weight

    Approximately 85-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00