1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD14
  5. CD14 Protein, Rat (HEK293, His)

The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, His) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, His) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD14 Protein functions as a coreceptor for bacterial lipopolysaccharide (LPS), forming a multi-protein complex with LY96 and TLR4. Collaborating with LBP, it binds monomeric LPS and delivers it to the LY96/TLR4 complex, initiating the innate immune response. CD14's involvement extends to TLR2:TLR6 and TLR2:TLR1 heterodimers, responding to diacylated and triacylated lipopeptides, respectively. Through interactions with MyD88, TIRAP, and TRAF6, CD14 activates NF-kappa-B, leading to cytokine secretion and inflammation. Additionally, it participates in LDL(-)-induced cytokine release and interacts with LPAR1, MYO18A, and FSTL1, highlighting its diverse roles in immune and signaling pathways.

Biological Activity

Measured by its ability to enhance LPS-induced IL-6 secretion by mouse splenocytes. The ED50 for this effect is 0.488 μg/mL, corresponding to a specific activity is 2049.180 U/mg.

  • Measured by its ability to enhance LPS-induced IL-6 secretion by mouse splenocytes. The ED50 for this effect is 0.488 μg/mL, corresponding to a specific activity is 2049.180 U/mg.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q63691 (S18-Y341)

Gene ID
Molecular Construction
N-term
CD14 (M1-Y341)
Accession # Q63691
His
C-term
Protein Length

Partial

Synonyms
Monocyte Differentiation Antigen CD14; CD14
AA Sequence

SPATPEPCELDQDEESVRCYCNFSDPQPNWSSAFLCAGAEDVEFYGGGRSLEYLLKRVDTEANLGQYTDIIRSLPLKRLTVRSARVPTQILFGTLRVLGYSGLRELTLENLEVTGTALSPLLDATGPDLNTLSLRNVSWATTDTWLAELQQWLKPGLKVLSIAQAHSLNFSCKQVGVFPALATLDLSDNPELGEKGLISALCPHKFPTLQVLALRNAGMETTSGVCSALAAARVPLQALDLSHNSLRDTAGTPSCDWPSQLNSLNLSFTGLEHVPKGLPAKLSVLDLSYNRLDRKPRPEELPEVGSLSLTGNPFLHSESQSEAY

Molecular Weight

Approximately 45-57 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD14 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD14 Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD14 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74331
Quantity:
MCE Japan Authorized Agent: