1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD14 B7-H3/CD276
  5. CD14 Protein, Rat (HEK293, His)

CD14 Protein, Rat (HEK293, His)

Cat. No.: HY-P74331
Handling Instructions

The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, His) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD14 Protein, Rat (HEK293, His) is 324 a.a., with molecular weight of 45-57 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, His) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD14 Protein, Rat (HEK293, His) is 324 a.a., with molecular weight of 45-57 kDa.

Background

CD14 Protein functions as a coreceptor for bacterial lipopolysaccharide (LPS), forming a multi-protein complex with LY96 and TLR4. Collaborating with LBP, it binds monomeric LPS and delivers it to the LY96/TLR4 complex, initiating the innate immune response. CD14's involvement extends to TLR2:TLR6 and TLR2:TLR1 heterodimers, responding to diacylated and triacylated lipopeptides, respectively. Through interactions with MyD88, TIRAP, and TRAF6, CD14 activates NF-kappa-B, leading to cytokine secretion and inflammation. Additionally, it participates in LDL(-)-induced cytokine release and interacts with LPAR1, MYO18A, and FSTL1, highlighting its diverse roles in immune and signaling pathways.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q63691 (S18-Y341)

Gene ID

60350  [NCBI]

Molecular Construction
N-term
CD14 (M1-Y341)
Accession # Q63691
His
C-term
Synonyms
Monocyte Differentiation Antigen CD14; CD14
AA Sequence

SPATPEPCELDQDEESVRCYCNFSDPQPNWSSAFLCAGAEDVEFYGGGRSLEYLLKRVDTEANLGQYTDIIRSLPLKRLTVRSARVPTQILFGTLRVLGYSGLRELTLENLEVTGTALSPLLDATGPDLNTLSLRNVSWATTDTWLAELQQWLKPGLKVLSIAQAHSLNFSCKQVGVFPALATLDLSDNPELGEKGLISALCPHKFPTLQVLALRNAGMETTSGVCSALAAARVPLQALDLSHNSLRDTAGTPSCDWPSQLNSLNLSFTGLEHVPKGLPAKLSVLDLSYNRLDRKPRPEELPEVGSLSLTGNPFLHSESQSEAY

Molecular Weight

Approximately 45-57 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD14 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74331
Quantity:
MCE Japan Authorized Agent: