1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins
  4. PSGL-1/CD162
  5. CD162/PSGL-1 Protein, Human (HEK293, His-Fc)

CD162/PSGL-1 Protein is a sialomucin expressed on leukocytes, which through high affinity, calcium-dependent interactions with E- and P-selectins, mediates rapid rolling of leukocytes over vascular surfaces during the initial steps in inflammation. CD162/PSGL-1 Protein, Human (HEK293, His-Fc) is the recombinant human-derived CD162/PSGL-1 protein, expressed by HEK293 , with C-His, C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD162/PSGL-1 Protein is a sialomucin expressed on leukocytes, which through high affinity, calcium-dependent interactions with E- and P-selectins, mediates rapid rolling of leukocytes over vascular surfaces during the initial steps in inflammation[1]. CD162/PSGL-1 Protein, Human (HEK293, His-Fc) is the recombinant human-derived CD162/PSGL-1 protein, expressed by HEK293 , with C-His, C-hFc labeled tag.

Background

In humans, P-selectin glycoprotein ligand-1 (PSGL-1) (or cluster differentiation (CD) 162) is coded by selectin P ligand (SELPLG). This cellular transmembrane receptor is expressed on most hematopoietic cells, including T-cells, B-cells, neutrophils, monocytes, and platelets. PSGL-1 is a critical proinflammatory protein that is essential for the recruitment of immune cells into sites of inflammation. As such, PSGL-1 significantly contributes to the relocation of immune cells from the circulating blood to inflamed tissue. A major question concerning selectin ligands is whether they mediate physiologically relevant cell-cell interaction. PSGL-1 on other classes of leukocytes such as monocytes, T lymphocytes, and mast cells as well as on hematopoietic stem cells is likely to be a predominant ligand for P-selectin. PSGL-1 is an HIV restriction factor and HIV, in turn, utilizes several mechanisms to counter PSGL-1 activity[1].

Species

Human

Source

HEK293

Tag

C-His;C-hFc

Accession

AAC50061.1 (L18-V295)

Gene ID
Molecular Construction
N-term
PSGL-1 (L18-V295)
Accession # AAC50061.1
hFc-His
C-term
Protein Length

Partial

Synonyms
P-selectin glycoprotein ligand 1; PSGL-1; Selectin P ligand; CD162; SELPLG
AA Sequence

LQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAASNLSV

Predicted Molecular Mass
57.1 kDa
Molecular Weight

Approximately 110-120 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

CD162/PSGL-1 Protein, Human (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD162/PSGL-1 Protein, Human (HEK293, His-Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD162/PSGL-1 Protein, Human (HEK293, His-Fc)
Cat. No.:
HY-P77162
Quantity:
MCE Japan Authorized Agent: