1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD19 B Cell CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. CD19 Protein, Cynomolgus/Rhesus Macaque (273a.a, HEK293, Fc)

CD19 Protein, Cynomolgus/Rhesus Macaque (273a.a, HEK293, Fc)

Cat. No.: HY-P7833
Handling Instructions

CD19 is a signaling component of the B-cell receptor complex that lowers the threshold for antigen-driven activation. CD19 Protein, Cynomolgus/Rhesus Macaque (273a.a, HEK293, Fc) is the recombinant Rhesus Macaque-derived CD19 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD19 Protein, Cynomolgus/Rhesus Macaque (273a.a, HEK293, Fc) is 273 a.a., with molecular weight of 80-110 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD19 is a signaling component of the B-cell receptor complex that lowers the threshold for antigen-driven activation. CD19 Protein, Cynomolgus/Rhesus Macaque (273a.a, HEK293, Fc) is the recombinant Rhesus Macaque-derived CD19 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD19 Protein, Cynomolgus/Rhesus Macaque (273a.a, HEK293, Fc) is 273 a.a., with molecular weight of 80-110 kDa.

Background

CD19 is a signaling component of the B-cell receptor complex and a regulator that drives B-cell differentiation and germinal center (GC) formation by lowering the threshold for antigen-driven activation. CD19 forms a complex with multiple membrane proteins, including complement receptor type 2 (CD21) and tetraspanin (CD81), thereby lowering the threshold for antigen-primed B cell activation. The CD19 complex then activates the phosphatidylinositol 3-kinase signaling pathway and subsequently releases intracellular stored calcium ions. CD19 is used in chimeric antigen receptor (CAR) T cells to treat lymphocytic leukemia. Anti-CD19 CAR-T cell approaches have been used to treat B-cell malignancies and play a key role in systemic lupus erythematosus (SLE), where B-cell activation is dysregulated. CD19 also has a biological relationship with coronaviruses and may be involved in immune responses or antiviral activities.

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

F7F486 (P20-K292)

Gene ID

705211  [NCBI]

Molecular Construction
N-term
CD19 (P20-K292)
Accession # F7F486
hFc
C-term
Synonyms
rRhCD19 molecule/CD19, Fc; B-Lymphocyte Antigen CD19; B-Lymphocyte Surface Antigen B4; Differentiation Antigen CD19; T-Cell Surface Antigen Leu-12; CD19
AA Sequence

PQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK

Molecular Weight

80-110 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD19 Protein, Cynomolgus/Rhesus Macaque (273a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD19 Protein, Cynomolgus/Rhesus Macaque (273a.a, HEK293, Fc)
Cat. No.:
HY-P7833
Quantity:
MCE Japan Authorized Agent: