CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (HEK293, hFc)

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (HEK293, hFc) is the recombinant human-derived CD276/B7-H3, expressed by HEK293, with C-hFc labeled tag.

The CD276/B7-H3 protein is suggested to play a multifaceted role in the regulation of T-cell-mediated immune responses, potentially acting as a protective factor in tumor cells by inhibiting natural-killer-mediated cell lysis and serving as a marker for the detection of neuroblastoma cells. Additionally, CD276/B7-H3 may be involved in the development of acute and chronic transplant rejection, contributing to the regulation of lymphocytic activity at mucosal surfaces. Notably, it could play a crucial role in providing the placenta and fetus with an immunologically suitable environment throughout pregnancy. Both isoform 1 and isoform 2 of CD276/B7-H3 appear redundant in their ability to modulate CD4 T-cell responses, with isoform 2 demonstrated to enhance the induction of cytotoxic T-cells and selectively stimulate interferon-gamma production in the presence of T-cell receptor signaling. The interaction with TREML2 is identified as enhancing T-cell activation, highlighting the diverse roles CD276/B7-H3 may play in immune regulation and cellular responses.

Human

HEK293

C-hFc

Q5ZPR3-1 (L29-T461)

80381  [NCBI]

Partial

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT

Approximately 110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.