1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins
  4. CD3d
  5. CD3 delta Protein, Cynomolgus (HEK293, Fc)

CD3 delta Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P70091
Handling Instructions

CD3 δ protein is a component of the TCR-CD3 complex on T lymphocytes and plays a crucial role in adaptive immunity. Activated by APC, TCR signals through the CD3 chain, including CD3D, CD3E, CD3G, and CD3Z. CD3 delta Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD3 delta protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD3 delta Protein, Cynomolgus (HEK293, Fc) is 84 a.a., with molecular weight of ~35.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD3 δ protein is a component of the TCR-CD3 complex on T lymphocytes and plays a crucial role in adaptive immunity. Activated by APC, TCR signals through the CD3 chain, including CD3D, CD3E, CD3G, and CD3Z. CD3 delta Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD3 delta protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD3 delta Protein, Cynomolgus (HEK293, Fc) is 84 a.a., with molecular weight of ~35.0 kDa.

Background

CD3 delta Protein, an integral component of the TCR-CD3 complex on the surface of T-lymphocytes, is crucial for the adaptive immune response. Upon activation by antigen-presenting cells (APCs), the T-cell receptor (TCR) transmits signals through CD3 chains, including CD3D, CD3E, CD3G, and CD3Z, each containing immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domains. When engaged by the TCR, these motifs undergo phosphorylation by Src family protein tyrosine kinases LCK and FYN, initiating downstream signaling pathways. Beyond its role in signal transduction for T-cell activation, CD3D is indispensable for thymocyte differentiation, contributing to the accurate assembly and surface expression of the TCR-CD3 complex. In the absence of a functional TCR-CD3 complex, thymocytes struggle with proper differentiation. CD3D interacts with CD4 and CD8, establishing a functional link between the TCR and coreceptors CD4 and CD8, essential for the activation and positive selection of CD4 or CD8 T-cells. The TCR-CD3 complex consists of CD3D/CD3E and CD3G/CD3E heterodimers, forming TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. This hexamer interacts with CD3Z homodimers, forming the complete TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be substituted by TCRgamma and TCRdelta. CD3D's intricate interactions underscore its pivotal role in orchestrating T-cell responses.

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

Q95LI8 (F22-A105)

Gene ID

102133701  [NCBI]

Molecular Construction
N-term
CD3 delta (F22-A105)
Accession # Q95LI8
hFc
C-term
Synonyms
rCynT-cell surface glycoprotein CD3 delta chain/CD3d, Fc ; T-cell surface glycoprotein CD3 delta chain; T-cell receptor T3 delta chain; CD3d; CD3D
AA Sequence

FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLA

Molecular Weight

Approximately 35.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD3 delta Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3 delta Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P70091
Quantity:
MCE Japan Authorized Agent: