CD3 delta Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD3 δ protein is a component of the TCR-CD3 complex on T lymphocytes and plays a crucial role in adaptive immunity. Activated by APC, TCR signals through the CD3 chain, including CD3D, CD3E, CD3G, and CD3Z. CD3 delta Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD3 delta protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD3 δ protein is a component of the TCR-CD3 complex on T lymphocytes and plays a crucial role in adaptive immunity. Activated by APC, TCR signals through the CD3 chain, including CD3D, CD3E, CD3G, and CD3Z. CD3 delta Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD3 delta protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD3 delta Protein, an integral component of the TCR-CD3 complex on the surface of T-lymphocytes, is crucial for the adaptive immune response. Upon activation by antigen-presenting cells (APCs), the T-cell receptor (TCR) transmits signals through CD3 chains, including CD3D, CD3E, CD3G, and CD3Z, each containing immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domains. When engaged by the TCR, these motifs undergo phosphorylation by Src family protein tyrosine kinases LCK and FYN, initiating downstream signaling pathways. Beyond its role in signal transduction for T-cell activation, CD3D is indispensable for thymocyte differentiation, contributing to the accurate assembly and surface expression of the TCR-CD3 complex. In the absence of a functional TCR-CD3 complex, thymocytes struggle with proper differentiation. CD3D interacts with CD4 and CD8, establishing a functional link between the TCR and coreceptors CD4 and CD8, essential for the activation and positive selection of CD4 or CD8 T-cells. The TCR-CD3 complex consists of CD3D/CD3E and CD3G/CD3E heterodimers, forming TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. This hexamer interacts with CD3Z homodimers, forming the complete TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be substituted by TCRgamma and TCRdelta. CD3D's intricate interactions underscore its pivotal role in orchestrating T-cell responses.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD3 delta (F22-A105)
      Accession # Q95LI8
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD3D; CD3d Molecule, Delta (CD3-TCR Complex); Prev. T3D; CD3 Antigen, Delta Subunit; T-Cell Surface Glycoprotein CD3 Delta Chain; OKT3, Delta Chain; T-Cell Receptor T3 Delta Chain; CD3d Molecule; CD3-DELTA; CD3d Antigen; CD3DELTA; IMD19; CD3d Antigen, Del

  • AA Sequence

    FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLA

  • Predicted Molecular Mass

    10.4 kDa

  • Molecular Weight

    Approximately 20-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00