CD3 gamma Protein, Cynomolgus (P.pastoris, His)
CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Cynomolgus
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD3γ protein on lymphocytes is a component of the TCR-CD3 complex and is critical for adaptive immune responses. When the TCR is activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals and activate downstream pathways. CD3 gamma Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived CD3 gamma protein, expressed by P. pastoris , with N-His labeled tag.
Background
CD3 gamma Protein is an integral part of the TCR-CD3 complex found on the surface of T-lymphocytes, playing a crucial role in adaptive immune response. When T-cell receptors (TCRs) on antigen presenting cells (APCs) are activated, CD3D, CD3E, CD3G, and CD3Z transmit TCR-mediated signals across the cell membrane. Each CD3 chain contains immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain, which are phosphorylated by LCK and FYN protein tyrosine kinases upon TCR engagement, leading to downstream signaling activation. Apart from signal transduction, CD3G also plays a vital role in regulating TCR expression at the cell surface, particularly through the di-leucine-based (diL) receptor-sorting motif present in CD3G that influences constitutive TCR cycling. The TCR-CD3 complex consists of CD3D/CD3E and CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, respectively, forming TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. These trimers then interact with CD3Z homodimer to form the complete TCR-CD3 complex. Alternatively, TCRgamma and TCRdelta can replace TCRalpha and TCRbeta in this complex.
Technical Parameters
-
Species Cynomolgus
-
Source P. pastoris
-
Tag N-His
-
Accession
Q95LI7 (Q23-T113)
-
Molecular Construction
-
N-term
-
His
-
CD3 gamma (Q23-T113)
Accession # Q95LI7 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD3G; T3G; CD3 Gamma Subunit Of T-Cell Receptor Complex; T-Cell Antigen Receptor Complex, Gamma Subunit Of T3; T-Cell Surface Glycoprotein CD3 Gamma Chain; CD3g Molecule, Epsilon (CD3-TCR Complex); T-Cell Receptor T3 Gamma Chain; TCR Ti Gamma-Chain V8-J2
-
AA Sequence
QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
-
Predicted Molecular Mass
12.5 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
