1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands CD30L/CD153
  5. CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, hFc)

CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, hFc)

Art. -Nr.: HY-P77321
Handling Instructions Technical Support

CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division. As for CD30 ligand in cynomolgus contains a transmembrane domain belonging to the tumor necrosis factor (TNF) family. CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, hFc) is expressed in the HEK293 cells with a N-terminal hFc-tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Verfügbarkeit
50 μg   Angebot einholen  
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

  • Verweise

Beschreibung

CD30 Ligand is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching[1]. CD30 Ligand is also a a marker for Hodgkin lymphoma and related hematologic malignancies, involves in activation and functioning of the T cell-dependent immune system[2]. CD30 ligand is expressed by T and B lymphocytes, macrophages, and a variety of normal haematopoietic cells and derived tumours. CD30 ligand exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division[3]. As for CD30 ligand in cynomolgus contains a transmembrane domain belonging to the tumor necrosis factor (TNF) family. CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, hFc) is expressed in the HEK293 cells with a N-terminal hFc-tag.

Background

CD30 Ligand (CD30L) is a B cell surface antigen and a ligand for CD30 (TNFRSF8), playing an inhibitory role in CD40-mediated immunoglobulin class switching[1].
CD30L is a type II membrane-associated glycoprotein belonging to the tumor necrosis factor (TNF) family, structurally related to tumour necrosis superfamily members TNF alpha, TNF beta, and CD40[1][3].
CD30L enhances cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines to play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. CD30L also enhances release of cytokine IL-6, TNF, LT-a[2].
CD30L exerts pleiotropic effects on normal and malignant lymphoid cells, including death, differentiation, or cell division regulation[3].
CD30L is mainly expressed on activated T cells, B cells, macrophages and DCs, while CD30/CD30L mainly expressed on the surface of activated CD4+ T cells in the lamina propria (LP), especially at the early stage of Th17 cell differentiation. CD30L deficiency could inhibit Th17 cell differentiation and production of IL-17A in the intestinal mucosa[4].
CD30L acts as a pro-inflammatory cytokines, is involved in the adaptive immune response in ulcerative colitis (UC), the level of which shows positive correlation with the severity of UC[5].

Species

Cynomolgus

Source

HEK293

Tag

N-hFc

Accession

G7P2F1 (Q63-D234)

Gene ID

/

Molecular Construction
N-term
hFc
CD30L (Q63-D234)
Accession # G7P2F1
C-term
Protein Length

Extracellular Domain

Synonyms
TNF superfamily member 8; CD153; CD30 Ligand; TNFSF8
AA Sequence

QRTDSIPNSPDNIPLRGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTVSVNVDTFQYIDTSTFPLENVLSVFLYSNSD

Predicted Molecular Mass
48.1 kDa
Molekulargewicht

Approximately 59 kDa,based on SDS-PAGE under reducing conditions.

Reinheit

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Dokumentation
Verweise
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, hFc)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
CD30 Ligand/TNFSF8 Protein, Cynomolgus (HEK293, hFc)
Art. -Nr.:
HY-P77321
Menge:
MCE Japan Authorized Agent: