CD3D Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The CD3D protein is an important component of the TCR-CD3 complex on T lymphocytes and is critical for adaptive immune responses. After APC activates TCR, CD3D, together with CD3E, CD3G and CD3Z, transmits signals through ITAM and activates downstream pathways. CD3D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD3D protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD3D protein is an important component of the TCR-CD3 complex on T lymphocytes and is critical for adaptive immune responses. After APC activates TCR, CD3D, together with CD3E, CD3G and CD3Z, transmits signals through ITAM and activates downstream pathways. CD3D Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD3D protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CD3D protein is a crucial component of the TCR-CD3 complex found on the surface of T-lymphocytes, playing a pivotal role in adaptive immune responses. Upon activation of the T-cell receptor (TCR) by antigen-presenting cells (APCs), CD3D, along with CD3E, CD3G, and CD3Z, transmits TCR-mediated signals across the cell membrane. These CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain, which, upon phosphorylation by LCK and FYN kinases, activate downstream signaling pathways. Beyond its role in signal transduction for T-cell activation, CD3D is indispensable in thymocyte differentiation, contributing to proper intracellular TCR-CD3 complex assembly and surface expression. Dysfunction in the TCR-CD3 complex leads to impaired thymocyte differentiation. CD3D further interacts with CD4 and CD8, establishing a functional link between the TCR and coreceptors CD4 and CD8, crucial for the activation and positive selection of CD4 or CD8 T-cells. The TCR-CD3 complex consists of CD3D/CD3E and CD3G/CD3E heterodimers, forming trimers that associate with TCRalpha and TCRbeta. Additionally, the hexamer interacts with CD3Z homodimer to complete the TCR-CD3 complex, wherein TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. This intricate interaction network highlights the multifaceted role of CD3D in orchestrating T-cell responses.

Verified Bioactivity

Immobilized Recombinant Human CD3 epsilon Protein at 10 µg/mL (100 µL/well) can bind Biotinylated Mouse CD3D protein. The ED50 for this effect is 4.477 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Recombinant Human CD3 epsilon Protein at 10 µg/mL (100 µL/well) can bind Biotinylated Mouse CD3D protein. The ED50 for this effect is 4.477 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD3D (M1-A105)
      Accession # P04235
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD3D; CD3d Molecule, Delta (CD3-TCR Complex); Prev. T3D; CD3 Antigen, Delta Subunit; T-Cell Surface Glycoprotein CD3 Delta Chain; OKT3, Delta Chain; T-Cell Receptor T3 Delta Chain; CD3d Molecule; CD3-DELTA; CD3d Antigen; CD3DELTA; IMD19; CD3d Antigen, Del

  • AA Sequence

    FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMA

  • Molecular Weight

    Approximately 44-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00