CD3E-CD3G Heterodimer Protein, Human (HEK293, Fc-Flag & mFc)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
50 μg	$926	In-stock	Estimated Time of Arrival: December 31
100 μg		Get quote
250 μg		Get quote

* Please select Quantity before adding items.

Biological Activity	Measured by its ability to bind OKT3-mIgG2a in a functional ELISA.
Species	Human
Source	HEK293
Tag	C-hFc;C-Flag;C-mFc
Accession	P07766/NP_000724 (D23-D126) & P09693/NP_000064 (Q23-S116)
Gene ID	916 [NCBI]&917
Synonyms	T-cell surface glycoprotein CD3 epsilon chain; CD3E; T3E; CD3 epsilon
AA Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Molecular Weight	42-47 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE
Appearance	Lyophilized powder.
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.
Storage & Stability	Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (233 KB) SDS (251 KB) COA (220 KB) Handling Instructions (2659 KB)

CD3E-CD3G Heterodimer Protein, Human (HEK293, Fc-Flag & mFc) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.