CD4 Protein, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

CD4 protein, an integral membrane glycoprotein, assumes a crucial role in immune responses, undertaking diverse functions against both external and internal challenges. In T-cells, its primary function is as a coreceptor for the MHC class II molecule:peptide complex, where class II peptides originate from extracellular proteins, while class I peptides are derived from cytosolic proteins. CD4 interacts concurrently with the T-cell receptor (TCR) and the MHC class II presented by antigen-presenting cells (APCs), leading to the recruitment of the Src kinase LCK to the vicinity of the TCR-CD3 complex. Subsequently, LCK initiates various intracellular signaling pathways by phosphorylating diverse substrates, ultimately resulting in lymphokine production, enhanced motility, adhesion, and the activation of T-helper cells. In other cell types such as macrophages or NK cells, CD4 contributes to differentiation/activation, cytokine expression, and cell migration through a TCR/LCK-independent pathway. Additionally, it plays a pivotal role in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages. Notably, CD4 acts as the primary receptor for human immunodeficiency virus-1 (HIV-1), with its down-regulation facilitated by HIV-1 Vpu, and it also serves as a receptor for Human Herpes virus 7/HHV-7^[1][2][3].

Measured by the ability of the immobilized protein to support the adhesion of NIH-3T3 mouse embryonic fibroblast cells. When 5×10⁴ cells/well are added to CD4-coated plates (1.25μg/mL and 100μL/well), approximately 53.82% will adhere specifically after 30 minutes at 37°C.

Others

HEK293

C-His

I6LI22 (R26-L401)

101684487  [NCBI]

Partial

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Approximately 52 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.