CD4 Protein, Ferret (HEK293, His)
Based on 1 Customer Validation
CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Others
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD4 protein, an integral membrane glycoprotein, assumes a crucial role in immune responses, undertaking diverse functions against both external and internal challenges. In T-cells, its primary function is as a coreceptor for the MHC class II molecule:peptide complex, where class II peptides originate from extracellular proteins, while class I peptides are derived from cytosolic proteins. CD4 interacts concurrently with the T-cell receptor (TCR) and the MHC class II presented by antigen-presenting cells (APCs), leading to the recruitment of the Src kinase LCK to the vicinity of the TCR-CD3 complex. Subsequently, LCK initiates various intracellular signaling pathways by phosphorylating diverse substrates, ultimately resulting in lymphokine production, enhanced motility, adhesion, and the activation of T-helper cells. In other cell types such as macrophages or NK cells, CD4 contributes to differentiation/activation, cytokine expression, and cell migration through a TCR/LCK-independent pathway. Additionally, it plays a pivotal role in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages. Notably, CD4 acts as the primary receptor for human immunodeficiency virus-1 (HIV-1), with its down-regulation facilitated by HIV-1 Vpu, and it also serves as a receptor for Human Herpes virus 7/HHV-7[1][2][3].
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of NIH-3T3 mouse embryonic fibroblast cells. When 5×104 cells/well are added to CD4-coated plates (1.25μg/mL and 100μL/well), approximately 53.82% will adhere specifically after 30 minutes at 37°C.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Others
-
Source HEK293
-
Tag C-His
-
Accession
I6LI22 (R26-L401)
-
Gene ID101684487 [NCBI]
-
Molecular Construction
-
N-term
-
CD4 (R26-L401)
Accession # I6LI22 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD4; CD4 Receptor; CD4 Molecule; Surface Glycoprotein Variant; T-Cell Surface Glycoprotein CD4; CD4 Antigen; T-Cell Surface Antigen T4/Leu-3; CD4 Protein; Leu-3; CD4mut; T4; IMD79; CD4 Antigen (P55); OKT4D
-
AA Sequence
REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)