1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. Inhibitory checkpoint molecules Cell Adhesion Molecules (CAMs)
  4. CD47 & SIRPα IgSF CAMs
  5. CD47 Protein, Human (121a.a, HEK293, His)

CD47 Protein, Human (121a.a, HEK293, His)

Cat. No.: HY-P7336
Handling Instructions

CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $120 In-stock
Estimated Time of Arrival: December 31
50 μg $320 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Tag

C-His

Accession

Q08722 (Q19-P139)

Gene ID

961

Synonyms
rHuCD47, His; CD47; MER6; IAP; OA3
AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPHHHHHH

Molecular Weight

35-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
2 µg/mL (100 µL/well) of immoblized recombinant human CD47-His can bind human SIRPa-Fc with a linear range of 20-65 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Targeting CD47 is in the spotlight of cancer immunotherapy. Blocking CD47 triggers the recognition and elimination of cancer cells by the innate immunity. The CD47/SIRP-α axis has been established as an important regulator of innate anti-cancer immunity, with many if not all malignancies overexpressing the receptor CD47 that binds to phagocyte-expressed SIRP-α[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD47 Protein, Human (121a.a, HEK293, His)
Cat. No.:
HY-P7336
Quantity:
MCE Japan Authorized Agent: