CD47 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.
Targeting CD47 is in the spotlight of cancer immunotherapy. Blocking CD47 triggers the recognition and elimination of cancer cells by the innate immunity. The CD47/SIRP-α axis has been established as an important regulator of innate anti-cancer immunity, with many if not all malignancies overexpressing the receptor CD47 that binds to phagocyte-expressed SIRP-α[1].
1.2 µg/mL (100 µL/well) of immoblized recombinant human CD47-His can bind human SIRPa-Fc with a linear range of 20-65 ng/mL.
2.Immobilized Human SIRPA-Fc at 10 μg/mL (100 μl/well) can bind Human CD47-His .The ED50 is 13.21 ng/mL
.
3.Measured by its binding ability in a functional ELISA. Immobilized Human SIRP alpha at 5 μg/mL (100 μL/well) can bind Biotinylated Human CD47 protein. The ED50 for this effect is 388.5 ng/mL.
4. Loaded Zeripatamig (HY-P990694) on AHC2 biosensor, can bind CD47 Protein, Human (HEK293, His) with an affinity constant of 1.692E-08 M as determined in BLI assay.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q08722-1/NP_942088.1 (Q19-P139)
-
Molecular Construction
-
N-term
-
CD47 (Q19-P139)
Accession # Q08722-1/NP_942088.1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD47; Antigen Identified By Monoclonal Antibody 1D8; Prev. MER6; Integrin-Associated Protein; Leukocyte Surface Antigen CD47; Rh-Related Antigen; IAP; CD47 Glycoprotein; Antigenic Surface Determinant Protein OA3; Integrin-Associated Signal Transducer; OA3
-
AA Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
-
Molecular Weight
Approximately 35-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
