1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Integrin Associated Protein/CD47
  5. CD47 Protein, Human (HEK293, His)

CD47 Protein, Human (HEK293, His)

Cat. No.: HY-P7336
COA Handling Instructions

CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $75 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Background

Targeting CD47 is in the spotlight of cancer immunotherapy. Blocking CD47 triggers the recognition and elimination of cancer cells by the innate immunity. The CD47/SIRP-α axis has been established as an important regulator of innate anti-cancer immunity, with many if not all malignancies overexpressing the receptor CD47 that binds to phagocyte-expressed SIRP-α[1].

Biological Activity

1.2 µg/mL (100 µL/well) of immoblized recombinant human CD47-His can bind human SIRPa-Fc with a linear range of 20-65 ng/mL.
2.Immobilized Human SIRPA-Fc at 10 μg/mL (100 μl/well) can bind Human CD47-His .The ED50 is 13.21 ng/mL
3. Immobilized Human CD47, His Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Human SIRP alpha, hFc Tag with the EC50 of 46.8ng/ml determined by ELISA (QC Test).
4. Human CD47, His Tag captured on CM5 Chip via Anti-His Antibody can bind Human SIRP alpha, hFc Tag with an affinity constant of 18.9nM as determined in SPR assay (Biacore T200).
5.Measured by its binding ability in a functional ELISA. Immobilized Human SIRP alpha at 5 μg/mL (100 μL/well) can bind Biotinylated Human CD47 protein. The ED50 for this effect is 388.5 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human SIRP alpha at 5 μg/mL (100 μL/well) can bind Biotinylated Human CD47 protein. The ED50 for this effect is 388.5 ng/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q08722/NP_942088.1 (Q19-P139)

Gene ID

961  [NCBI]

Molecular Construction
N-term
CD47 (Q19-P139)
Accession # Q08722
6*His
C-term
Synonyms
rHuCD47, His; CD47; MER6; IAP; OA3
AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPHHHHHH

Molecular Weight

30-45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS or 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD47 Protein, Human (HEK293, His)
Cat. No.:
HY-P7336
Quantity:
MCE Japan Authorized Agent: