CD58 Protein, Human (HEK293, Fc)

CD58 Protein, Human (HEK293, Fc) is the recombinant human-derived CD58 protein, expressed by HEK293, with C-hFc labeled tag.

CD58, a glycoprotein, also known as lymphocyte-function antigen 3 (LFA-3). CD58 is a costimulatory receptor, and is distributed on various human tissue cells, such as T lymphocytes, NK cells, thymocytes, and a subset of bone marrow cells. CD58 can interact with its natural ligand (CD2, primarily expressed on the surface of T/NK cells). The CD2-CD58 interaction can promote cell adhesion and recognition, and regulate antiviral responses, inflammatory responses in autoimmune diseases, immune rejection of transplantation, and immune evasion of tumor cells^[1].
CD58 has two isoforms: a type-I transmembrane form and a glycosylphosphatidylinositol (GPI)-anchored form. The GPI-anchored CD58 form is more effective in enhancing adhesion, but the transmembrane form is more critical for signal transduction. Furthermore, a soluble form of CD58 (sCD58) also exist in cellular supernatant in vitro and in local tissues in vivo. sCD58 is an immunosuppressive factor, and is involved in T/NK cell-mediated immune responses by affecting CD2-CD58 interaction. Altered accumulation of sCD58 may lead to immunosuppression of T/NK cells in the tumor microenvironment. Therefore, sCD58 as a novel immunotherapeutic target^[1].

1. Measured by its binding ability in a functional ELISA. Immobilized human CD2-His at 10 μg/mL (100 μl/well) can bind human CD58-Fc, The EC₅₀ of human CD58-Fc is 0.04-0.1 μg/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD2-His at 10 μg/mL (100 μl/well) can bind human CD58-Fc, The EC₅₀ of human CD58-Fc is 0.04-0.10 μg/mL.
3.Loaded Recombinant Human CD58/LFA-3 Protein, hFc Tag on ProA Biosensor, can bind Recombinant Human CD2 Protein, His Tag with an affinity constant of 1.36 μM as determined in BLI assay.

Human

HEK293

C-hFc

Q9BRW0 (F29-R215)

965  [NCBI]

Extracellular Domain

FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR

Approximately 68 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.