CD74 Protein, Mouse (224a.a, HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD74 protein is significantly expressed in the thymus and lymph nodes, suggesting that it plays a key role in regulating immune system function. Its presence in the thymus, a key site for T cell development, underscores its important role in overseeing key cellular processes required for immune maturation. CD74 Protein, Mouse (224a.a, HEK293, His) is the recombinant mouse-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD74 protein is significantly expressed in the thymus and lymph nodes, suggesting that it plays a key role in regulating immune system function. Its presence in the thymus, a key site for T cell development, underscores its important role in overseeing key cellular processes required for immune maturation. CD74 Protein, Mouse (224a.a, HEK293, His) is the recombinant mouse-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

Background

The CD74 protein is integral to the MHC class II antigen processing pathway, exerting a critical role by stabilizing peptide-free class II alpha/beta heterodimers shortly after their synthesis. Furthermore, CD74 guides the transport of this complex from the endoplasmic reticulum to compartments where peptide loading onto class II molecules occurs. Beyond its involvement in antigen presentation, CD74 enhances T-cell responses through interaction with CD44. Additionally, CD74 acts as a chaperone for mature cathepsin L (CTSL), stabilizing its conformation by binding to the active site. This chaperone function aids in maintaining a pool of mature enzyme within endocytic compartments and the extracellular space of antigen-presenting cells (APCs), illustrating the multifaceted role of CD74 in modulating immune responses at various stages of antigen processing and presentation.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • CD74 (Q56-L279)
      Accession # P04441-1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD74; Ia-Associated Invariant Chain; Prev. DHLAG; HLA-DR-Gamma; CLIP; Ia Antigen-Associated Invariant Chain; CD74 Antigen (Invariant Polypeptide Of Major Histocompatibility Complex, Class II Antigen-Associated); CD74 Antigen; CD74 Molecule, Major Histocom

  • AA Sequence

    QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

  • Predicted Molecular Mass

    26.5 kDa

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00