CD74 Protein, Mouse (224a.a, HEK293, His)
Based on 1 Customer Validation
The CD74 protein is significantly expressed in the thymus and lymph nodes, suggesting that it plays a key role in regulating immune system function. Its presence in the thymus, a key site for T cell development, underscores its important role in overseeing key cellular processes required for immune maturation. CD74 Protein, Mouse (224a.a, HEK293, His) is the recombinant mouse-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD74 protein is significantly expressed in the thymus and lymph nodes, suggesting that it plays a key role in regulating immune system function. Its presence in the thymus, a key site for T cell development, underscores its important role in overseeing key cellular processes required for immune maturation. CD74 Protein, Mouse (224a.a, HEK293, His) is the recombinant mouse-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.
Background
The CD74 protein is integral to the MHC class II antigen processing pathway, exerting a critical role by stabilizing peptide-free class II alpha/beta heterodimers shortly after their synthesis. Furthermore, CD74 guides the transport of this complex from the endoplasmic reticulum to compartments where peptide loading onto class II molecules occurs. Beyond its involvement in antigen presentation, CD74 enhances T-cell responses through interaction with CD44. Additionally, CD74 acts as a chaperone for mature cathepsin L (CTSL), stabilizing its conformation by binding to the active site. This chaperone function aids in maintaining a pool of mature enzyme within endocytic compartments and the extracellular space of antigen-presenting cells (APCs), illustrating the multifaceted role of CD74 in modulating immune responses at various stages of antigen processing and presentation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-8*His
-
Accession
P04441-1 (Q56-L279)
-
Molecular Construction
-
N-term
-
8*His
-
CD74 (Q56-L279)
Accession # P04441-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD74; Ia-Associated Invariant Chain; Prev. DHLAG; HLA-DR-Gamma; CLIP; Ia Antigen-Associated Invariant Chain; CD74 Antigen (Invariant Polypeptide Of Major Histocompatibility Complex, Class II Antigen-Associated); CD74 Antigen; CD74 Molecule, Major Histocom
-
AA Sequence
QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
-
Predicted Molecular Mass
26.5 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)