CD79A Protein, Human (HEK293, His)

The CD79A protein is critical for initiating the B cell antigen receptor complex (BCR) signaling cascade upon antigen binding. It promotes internalization, transport to late endosomes, and antigen presentation of BCR complexes. CD79A Protein, Human (HEK293, His) is the recombinant human-derived CD79A protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD79A protein is critical for initiating the B cell antigen receptor complex (BCR) signaling cascade upon antigen binding. It promotes internalization, transport to late endosomes, and antigen presentation of BCR complexes. CD79A Protein, Human (HEK293, His) is the recombinant human-derived CD79A protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CD79A protein is essential for the initiation of the signal transduction cascade in response to antigen binding to the B-cell antigen receptor complex (BCR). It plays a crucial role in internalizing the BCR complex, trafficking it to late endosomes, and facilitating antigen presentation. CD79A is also necessary for the surface expression of the BCR and efficient differentiation of pro- and pre-B-cells. It promotes the autophosphorylation and activation of SYK, a key signaling molecule, by binding to BLNK and bringing it into proximity with SYK, allowing for the phosphorylation of BLNK. CD79A also interacts with certain Src-family tyrosine kinases, such as FYN and LYN, increasing their activity. Notably, it represses BCR signaling during the development of immature B-cells. CD79A forms a disulfide-linked heterodimer with CD79B, and together they constitute the B-cell antigen receptor complex, where the alpha/beta chain heterodimer is non-covalently associated with an antigen-specific membrane-bound surface immunoglobulin composed of two heavy chains and two light chains. CD79A interacts with SYK through its phosphorylated ITAM domain, facilitating SYK autophosphorylation and activation. Additionally, when phosphorylated on Tyr-210, CD79A interacts with the SH2 domain of BLNK/SLP65, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK, which is necessary for the trafficking of the BCR to late endosomes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD79A (L33-R143)
      Accession # P11912-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD79A; MB-1; Prev. IGA; CD79A Antigen (Immunoglobulin-Associated Alpha); Ig-Alpha; CD79a Molecule, Immunoglobulin-Associated Alpha; B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain; Surface IgM-Associated Protein; MB1; MB-1 Membrane Glycopro

  • AA Sequence

    LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR

  • Predicted Molecular Mass

    13.4 kDa

  • Molecular Weight

    Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00