CD79A Protein, Human (HEK293, His)

The CD79A protein is critical for initiating the B cell antigen receptor complex (BCR) signaling cascade upon antigen binding. It promotes internalization, transport to late endosomes, and antigen presentation of BCR complexes. CD79A Protein, Human (HEK293, His) is the recombinant human-derived CD79A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD79A Protein, Human (HEK293, His) is 111 a.a., with molecular weight of 25-40 kDa.

The CD79A protein is essential for the initiation of the signal transduction cascade in response to antigen binding to the B-cell antigen receptor complex (BCR). It plays a crucial role in internalizing the BCR complex, trafficking it to late endosomes, and facilitating antigen presentation. CD79A is also necessary for the surface expression of the BCR and efficient differentiation of pro- and pre-B-cells. It promotes the autophosphorylation and activation of SYK, a key signaling molecule, by binding to BLNK and bringing it into proximity with SYK, allowing for the phosphorylation of BLNK. CD79A also interacts with certain Src-family tyrosine kinases, such as FYN and LYN, increasing their activity. Notably, it represses BCR signaling during the development of immature B-cells. CD79A forms a disulfide-linked heterodimer with CD79B, and together they constitute the B-cell antigen receptor complex, where the alpha/beta chain heterodimer is non-covalently associated with an antigen-specific membrane-bound surface immunoglobulin composed of two heavy chains and two light chains. CD79A interacts with SYK through its phosphorylated ITAM domain, facilitating SYK autophosphorylation and activation. Additionally, when phosphorylated on Tyr-210, CD79A interacts with the SH2 domain of BLNK/SLP65, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK, which is necessary for the trafficking of the BCR to late endosomes.

Human

HEK293

C-6*His

P11912 (L33-R143)

973  [NCBI]

LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR

25-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.