CD8 beta Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD8 beta is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 beta Protein, Human (HEK293, His) is the recombinant human-derived CD8 beta protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD8 beta is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 beta Protein, Human (HEK293, His) is the recombinant human-derived CD8 beta protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD8 beta, an integral membrane glycoprotein, plays a pivotal role in the immune response, serving multiple functions against both external and internal threats. In T-cells, its primary function is as a coreceptor for the MHC class I molecule:peptide complex, where antigens presented by class I peptides originate from cytosolic proteins. CD8 beta interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen-presenting cells (APCs), recruiting the Src kinase LCK to the vicinity of the TCR-CD3 complex. The presence of a palmitoylation site in the cytoplasmic tail of the CD8B chain facilitates the partitioning of CD8 into plasma membrane lipid rafts, enriching signaling proteins. Once LCK is recruited, it initiates diverse intracellular signaling pathways, phosphorylating various substrates and leading to lymphokine production, motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs). CD8 beta also plays a critical role in the thymic selection of CD8+ T-cells. At the cell surface, it forms disulfide-linked heterodimers with CD8A and interacts with CD3D, coupling TCR-CD3 with CD8, and also interacts with LCK.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD8 beta (L22-P170)
      Accession # P10966-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD8B; CD8b Molecule; Prev. CD8B1; Ly-3 Homolog (Mouse); T-Cell Surface Glycoprotein CD8 Beta Chain; Ly-3 Homolog; CD8beta; CD8b Antigen; LYT3; CD8 Antigen; Ly-3; LEU2; P37; LY3; CD8 Antigen, Beta Polypeptide 1 (P37); CD8 Subunit Beta; T Lymphocyte Surface

  • AA Sequence

    LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

  • Predicted Molecular Mass

    17.8 kDa

  • Molecular Weight

    Approximately 25-32 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00