1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Pattern Recognition Receptors
  4. AIM2-like receptors
  5. CD94
  6. CD94 Protein, Human (HEK293, His)

CD94 Protein, Human (HEK293, His)

Cat. No.: HY-P72700
COA Handling Instructions

CD94 protein is a key immune receptor for self-non-self discrimination. It forms a complex with KLRC1 or KLRC2 on lymphocyte subsets and recognizes HLA-E loaded with self-peptides. It allows cytotoxic cells to monitor MHC class I expression and promote self-tolerance. CD94 Protein, Human (HEK293, His) is the recombinant human-derived CD94 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $168 In-stock
50 μg $470 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD94 protein is a key immune receptor for self-non-self discrimination. It forms a complex with KLRC1 or KLRC2 on lymphocyte subsets and recognizes HLA-E loaded with self-peptides. It allows cytotoxic cells to monitor MHC class I expression and promote self-tolerance. CD94 Protein, Human (HEK293, His) is the recombinant human-derived CD94 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

CD94 Protein, an immune receptor crucial for self-nonself discrimination, forms a complex with KLRC1 or KLRC2 on cytotoxic and regulatory lymphocyte subsets, recognizing the non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia and other non-classical MHC class Ib molecules. This interaction enables cytotoxic cells to monitor MHC class I expression in healthy cells, fostering self-tolerance. Primarily serving as a ligand-binding subunit without the capacity to signal, the KLRD1-KLRC1 complex acts as an immune inhibitory receptor, with CD94 playing a key inhibitory role on natural killer (NK) cells. CD94 dominantly counteracts T cell receptor signaling on a subset of memory/effector CD8-positive T cells to prevent autoimmunity. On intraepithelial CD8-positive gamma-delta regulatory T cells, CD94 triggers TGFB1 secretion, limiting the cytotoxic programming of intraepithelial CD8-positive alpha-beta T cells and distinguishing harmless from pathogenic antigens. In the HLA-E-rich tumor microenvironment, CD94 acts as an immune inhibitory checkpoint, potentially contributing to the progressive loss of effector functions in NK cells and tumor-specific T cells, a state known as cell exhaustion. Upon HLA-E-peptide binding, CD94 transmits intracellular signals through KLRC1 immunoreceptor tyrosine-based inhibition motifs (ITIMs), recruiting INPP5D/SHIP-1 and INPPL1/SHIP-2 tyrosine phosphatases to ITIMs, ultimately opposing signals from activating receptors by dephosphorylating proximal signaling molecules.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

Q13241-1 (S34-I179)

Gene ID
Molecular Construction
N-term
6*His
CD94 (S34-I179)
Accession # Q13241-1
C-term
Synonyms
Natural killer cells antigen CD94; KP43; CD94; KLRD1
AA Sequence

SFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

Molecular Weight

23-28 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD94 Protein, Human (HEK293, His)
Cat. No.:
HY-P72700
Quantity:
MCE Japan Authorized Agent: