CEACAM3 Protein, Human (His-SUMO)

The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

CEACAM3 Protein emerges as a pivotal granulocyte receptor that orchestrates the efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, encompassing pathogens such as Neisseria, Moraxella, and Haemophilus species. This significant role positions CEACAM3 at the forefront of pathogen clearance within the innate immune system. In the course of pathogen phagocytosis, CEACAM3 takes on the responsibility of stimulating RAC1, further contributing to the cellular processes involved in pathogen engulfment. Notably, CEACAM3 engages in a calcium-dependent interaction with S100A9/calprotectin, a dynamic interaction that occurs independently of CEACAM3 phosphorylation. This intricate network of functions underscores the multifaceted role of CEACAM3 in orchestrating effective immune responses against a spectrum of microorganisms.

Human

E. coli

N-6*His;N-SUMO

P40198 (K35-G155)

1084  [NCBI]

Extracellular Domain

KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.