CEACAM6 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

CEACAM6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived CEACAM6 protein, expressed by HEK293, with C-His & C-Avi tag.

CEACAM6 protein, a cell surface glycoprotein, assumes a pivotal role in cell adhesion and tumor progression. Interactions occur in a calcium- and fibronectin-independent manner, mediating both homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules like CEACAM5 and CEACAM8. Particularly, heterophilic interaction with CEACAM8 takes place in activated neutrophils, influencing neutrophil adhesion to cytokine-activated endothelial cells. In the context of tumor progression, CEACAM6 operates as an oncogene by positively regulating cell migration, adhesion to endothelial cells, and invasion. Additionally, it contributes to the metastatic cascade by inducing resistance to anoikis in pancreatic adenocarcinoma and colorectal carcinoma cells. CEACAM6 forms homodimers, engaging in homodimerization via its Ig-like V-type domain, and also forms heterodimers with CEACAM8 through their respective Ig-like V-type domains, highlighting its multifaceted role in cell adhesion and cancer-related processes.

Cynomolgus

HEK293

C-Avi;C-8*His

XP_005589488.3 (Q35-G320)

135964351

Partial

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

QLTIESRPFAVNEGKEVLLLAHNLPQNLIGFNWYKGERVDAKRLIVAYVIGTQQTTPGPAHSGREMIYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGRFWVYPELPKPYITSNNSNPVEDKDAVDFTCEPDIHSTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVKRNDAGAYECEIQNPVSANFSDPVILNVLYGPDVPTISPSNSNYRPGENLNLSCHAASNPTAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAYNSATGLNRTTVMMITVSG

Approximately 60-80 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.