CGA-CGB3 Heterodimer Protein, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CGA-CGB3 Heterodimer Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived CGA-CGB3 Heterodimer protein, expressed by HEK293 , with C-6*His labeled tag. CGA-CGB3 Heterodimer Protein, Human (HEK293, His), has molecular weight of 22 & 30-35 kDa, respectively.

The CG alpha protein serves as the shared alpha chain in the active heterodimeric glycoprotein hormones, including thyrotropin (TSH), lutropin (LH), follitropin (FSH), and choriogonadotropin (CG). These hormones bind to specific receptors on target cells, initiating downstream signaling pathways. The heterodimeric structure of these hormones involves the CG alpha chain, as described here, and a unique beta chain, which imparts biological specificity to each hormone. Specifically, TSH consists of CG alpha and TSH beta (TSHB), lutropin comprises CG alpha and LH beta (LHB), follitropin includes CG alpha and FSH beta (FSHB), and choriogonadotropin is composed of CG alpha and choriogonadotropin subunit beta (CGB).

Human

HEK293

C-6*His

P01215 (A25-S116)&P0DN86 (S21-Q165)

1081  [NCBI]&1082  [NCBI]

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

22&30-35 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.