Clusterin/APOJ Protein, Human (HEK293, Fc-His)

Clusterin/APOJ Protein, Human (HEK293, Fc-His) expresses in HEK293 with an Fc fragment and a His tag at the N-terminus. Apolipoprotein J (ApoJ) is involved in numerous physiological process important for lipid transportation, vascular smooth muscle cell differentiation, and has the potential for atherosclerosis^[1].

Apolipoprotein J (apoJ), also known as clusterin (CLU), which is tightly associated with both lipid and apoAl in HDLs in blood, has been proposed as such biomarker through numerous researches. In the process of relieving atherosclerosis, apoJ can promote cholesterol and phospholipid export from macrophage-foam cells, and exhibit cytoprotective and anti-inflammatory actions by interacting with lots of known inflammatory proteins which may predict the onset of clinical cardiovascular events and may actually play a causal role in mediating atherosclerotic disease such as C-reactive protein, paraoxonase, and leptin^[1].

Measured by its ability to induce clustering of Caki-2 human clear cell carcinoma epithelial cells.

Human

HEK293

C-6*His;C-Fc

P10909 (D23-E449)

1191  [NCBI]

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Approximately (35-40) & (61-79) & 90 kD

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Yang N, et al. Apolipoprotein J: A New Predictor and Therapeutic Target in Cardiovascular Disease? Chin Med J (Engl). 2015 Sep 20;128(18):2530-4.  [Content Brief]