CNTF Protein, Rat

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family^[1]. CNTF could protect retinal cone and rod photoreceptors^[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons^[3]. CNTF Protein, Rat is produced by E. coli (A2-M200) with tag freeg.

Ciliary Neurotrophic Factor (CNTF) belongs to the IL-6 cytokine family. IL-6, IL-11 and CNTF are associated with cytokine trans signaling. CNTF shows a low affinity interaction with IL-6 receptor subunit alpha (IL-6Rα), leading to the formation and activation of the IL-6Rβ/gp130/LIFR signaling receptor complex^[1]. CNTF is also an extracellular signaling protein in the neuroretinal and the interphotoreceptor matrix, which is associated with the membranes of the RPE, Muller and photoreceptor cells^[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. Because it promotes differentiation and maturation of oligodendrocyte precursor cells to oligodendrocytes under in vitro conditions and thus improves remyelination. Importantly, it also increases the survival of mature oligodendrocytes^[3]. The similarity of human CNTF protein sequences to mice and rats was 81.82% and 84.0%, respectively.

CNTF (rat; 1 ng/mL; 3-21 d) affects the levels of choline acetyltransferase (CHAT) and tyrosine hydroxylase (TH) in isolated sympathetic nerve cell cultures of newborn rats^[4].

The ED₅₀ is <30 ng/mL as measured by its ability to induce alkaline phosphatase production by TF-1 cells.

Rat

E. coli

Tag Free

P20294 (A2-M200)

25707  [NCBI]

AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM

Approximately 22.9 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 50 mM Tris, pH 8.0.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18(12):773-789.  [Content Brief]

  [2]. Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293(39):15256-15268.  [Content Brief]

  [3]. Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17(7):912-21.  [Content Brief]

  [4]. Saadat S, et al. Ciliary neurotrophic factor induces cholinergic differentiation of rat sympathetic neurons in culture[J]. The Journal of cell biology, 1989, 108(5): 1807-1816.