CTLA-4 Protein, Canine (HEK293, Fc)

CTLA-4 protein inhibits T-cell responses as a critical negative regulator, with a stronger affinity for CD80 and CD86 than CD28. This affinity allows CTLA-4 to effectively suppress T-cell activation and regulate immune responses, maintaining a delicate equilibrium in T-cell-mediated immunity. CTLA-4 Protein, Canine (HEK293, Fc) is the recombinant canine-derived CTLA-4 protein, expressed by HEK293 , with C-hFc labeled tag.

CTLA-4 protein functions as a critical inhibitory receptor, playing a pivotal role as a major negative regulator in T-cell responses. The distinguishing feature of CTLA-4 lies in its significantly stronger affinity for its natural B7 family ligands, CD80 and CD86, compared to the affinity of their corresponding stimulatory coreceptor, CD28. This heightened affinity enables CTLA-4 to effectively counterbalance and suppress T-cell activation, contributing to the intricate regulation of immune responses. The dynamic interplay between CTLA-4 and its ligands underscores its significance in fine-tuning the immune system and maintaining a delicate equilibrium between activation and inhibition in T-cell-mediated immunity.

Canine

HEK293

C-hFc

Q9GKP2 (K36-D161)

403696  [NCBI]

Partial

KGMHVAQPAVVLASSRGVASFVCEYGSSGNAAEVRVTVLRQAGSQMTEVCAATYTVEDELAFLDDSTCTGTSSGNKVNLTIQGLRAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIDPEPCPDSD

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.